Parduczia
''Parduczia'' is a genus of karyorelict ciliates in the family Geleiidae. ''Parduczia'' species are filiform to serpentiform ciliates characterized by their giant size (1200 to 2500 µm on average) and their very long buccal split. The genus name is a taxonomic patronym honoring the protistologist Béla Párducz (1911–1964). Systematics Five species are currently described in the genus ''Parduczia''. * ''Parduczia arcachonense'' (Nouzarède, 1965) Dragesco, 1999 * ''Parduczia filiformis'' (Nouzarède, 1977) Dragesco, 1999 * ''Parduczia martinicense'' (Nouzarède, 1977) Dragesco, 1999 * ''Parduczia murmanica'' (Raikov, 1962) Dragesco, 1999 * ''Parduczia orbis'' (Fauré-Fremiet, 1950) Dragesco, 1999 is the type species of the genus. Phylogeny Comparison and phylogenetic analysis of 18S rRNA sequences showed that ''Parduczia orbis'' is the sister group to '' Corlissina maricaensis''. In turn, these two genera form a clade with ''Geleia''. Alternative genetic code An alt ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Parduczia Arcachonense
''Parduczia'' is a genus of karyorelict ciliates in the family Geleiidae. ''Parduczia'' species are filiform to serpentiform ciliates characterized by their giant size (1200 to 2500 µm on average) and their very long buccal split. The genus name is a taxonomic patronym honoring the protistologist Béla Párducz (1911–1964). Systematics Five species are currently described in the genus ''Parduczia''. * '' Parduczia arcachonense'' (Nouzarède, 1965) Dragesco, 1999 * '' Parduczia filiformis'' (Nouzarède, 1977) Dragesco, 1999 * '' Parduczia martinicense'' (Nouzarède, 1977) Dragesco, 1999 * '' Parduczia murmanica'' (Raikov, 1962) Dragesco, 1999 * '' Parduczia orbis'' (Fauré-Fremiet, 1950) Dragesco, 1999 is the type species of the genus. Phylogeny Comparison and phylogenetic analysis of 18S rRNA sequences showed that ''Parduczia orbis'' is the sister group to '' Corlissina maricaensis''. In turn, these two genera form a clade with ''Geleia ''Geleia'' is a genus of ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Parduczia Filiformis
''Parduczia'' is a genus of karyorelict ciliates in the family Geleiidae. ''Parduczia'' species are filiform to serpentiform ciliates characterized by their giant size (1200 to 2500 µm on average) and their very long buccal split. The genus name is a taxonomic patronym honoring the protistologist Béla Párducz (1911–1964). Systematics Five species are currently described in the genus ''Parduczia''. * ''Parduczia arcachonense'' (Nouzarède, 1965) Dragesco, 1999 * '' Parduczia filiformis'' (Nouzarède, 1977) Dragesco, 1999 * '' Parduczia martinicense'' (Nouzarède, 1977) Dragesco, 1999 * '' Parduczia murmanica'' (Raikov, 1962) Dragesco, 1999 * '' Parduczia orbis'' (Fauré-Fremiet, 1950) Dragesco, 1999 is the type species of the genus. Phylogeny Comparison and phylogenetic analysis of 18S rRNA sequences showed that ''Parduczia orbis'' is the sister group to '' Corlissina maricaensis''. In turn, these two genera form a clade with ''Geleia ''Geleia'' is a genus of k ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Parduczia Martinicense
''Parduczia'' is a genus of karyorelict ciliates in the family Geleiidae. ''Parduczia'' species are filiform to serpentiform ciliates characterized by their giant size (1200 to 2500 µm on average) and their very long buccal split. The genus name is a taxonomic patronym honoring the protistologist Béla Párducz (1911–1964). Systematics Five species are currently described in the genus ''Parduczia''. * ''Parduczia arcachonense'' (Nouzarède, 1965) Dragesco, 1999 * ''Parduczia filiformis'' (Nouzarède, 1977) Dragesco, 1999 * '' Parduczia martinicense'' (Nouzarède, 1977) Dragesco, 1999 * '' Parduczia murmanica'' (Raikov, 1962) Dragesco, 1999 * '' Parduczia orbis'' (Fauré-Fremiet, 1950) Dragesco, 1999 is the type species of the genus. Phylogeny Comparison and phylogenetic analysis of 18S rRNA sequences showed that ''Parduczia orbis'' is the sister group to '' Corlissina maricaensis''. In turn, these two genera form a clade with ''Geleia ''Geleia'' is a genus of ka ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Parduczia Murmanica
''Parduczia'' is a genus of karyorelict ciliates in the family Geleiidae. ''Parduczia'' species are filiform to serpentiform ciliates characterized by their giant size (1200 to 2500 µm on average) and their very long buccal split. The genus name is a taxonomic patronym honoring the protistologist Béla Párducz (1911–1964). Systematics Five species are currently described in the genus ''Parduczia''. * ''Parduczia arcachonense'' (Nouzarède, 1965) Dragesco, 1999 * ''Parduczia filiformis'' (Nouzarède, 1977) Dragesco, 1999 * ''Parduczia martinicense'' (Nouzarède, 1977) Dragesco, 1999 * '' Parduczia murmanica'' (Raikov, 1962) Dragesco, 1999 * '' Parduczia orbis'' (Fauré-Fremiet, 1950) Dragesco, 1999 is the type species of the genus. Phylogeny Comparison and phylogenetic analysis of 18S rRNA sequences showed that ''Parduczia orbis'' is the sister group to '' Corlissina maricaensis''. In turn, these two genera form a clade with ''Geleia ''Geleia'' is a genus of kar ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Parduczia Orbis
''Parduczia'' is a genus of karyorelict ciliates in the family Geleiidae. ''Parduczia'' species are filiform to serpentiform ciliates characterized by their giant size (1200 to 2500 µm on average) and their very long buccal split. The genus name is a taxonomic patronym honoring the protistologist Béla Párducz (1911–1964). Systematics Five species are currently described in the genus ''Parduczia''. * ''Parduczia arcachonense'' (Nouzarède, 1965) Dragesco, 1999 * ''Parduczia filiformis'' (Nouzarède, 1977) Dragesco, 1999 * ''Parduczia martinicense'' (Nouzarède, 1977) Dragesco, 1999 * ''Parduczia murmanica'' (Raikov, 1962) Dragesco, 1999 * '' Parduczia orbis'' (Fauré-Fremiet, 1950) Dragesco, 1999 is the type species of the genus. Phylogeny Comparison and phylogenetic analysis of 18S rRNA sequences showed that ''Parduczia orbis'' is the sister group to '' Corlissina maricaensis''. In turn, these two genera form a clade with ''Geleia ''Geleia'' is a genus of kary ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Geleia
''Geleia'' is a genus of karyorelict ciliates in the family Geleiidae. The genus name is a taxonomic patronym honoring the Hungarian protistologist József von Gelei (1885-1952). Systematics 17 species are currently described in the genus ''Geleia''. * ''Geleia acuta'' Dragesco, 1960 * '' Geleia decolor'' Kahl, 1933 * '' Geleia filiformes'' Nouzarède, 1976 * '' Geleia fossata'' Kahl, 1933 is the type species of the genus. * '' Geleia heterotricha'' Dragesco, 1960, redescribed as '' Gellertia heterotricha'' Dragesco, 1999 * '' Geleia hyalina'' Dragesco, 1960 * '' Geleia luci'' Dragesco, 1960 * '' Geleia major'' Dragesco, 1954 * '' Geleia martinicense'' Nouzarède, 1976 * '' Geleia murmanica'' Raikov, 1962 * ''Geleia nigriceps'' Kahl, 1933 * '' Geleia obliqua'' Dragesco, 1960 * '' Geleia orbis'' Fauré-Fremiet, 1951 * ''Geleia simplex'' Fauré-Fremiet, 1951 * ''Geleia swedmarki'' Dragesco * ''Geleia tenuis'' Dragesco, 1954 * ''Geleia vacuolata'' Dragesco, 1960 Phylogeny C ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Corlissina
''Corlissina'' is a genus of karyorelict ciliates in the family Geleiidae. Only the type species ''Corlissina maricaensis'' is assigned to this genus. ''Corlissina'' is characterized by a paroral ciliature with two rows of polykineties forming a loop at the posterior end. The dikinetids of the adoral zone are organized in short polykineties, followed by a row of monokinetids. The two globular macronuclei are linked by a single micronucleus, a pattern found in most Geleiidae. The genus name is a taxonomic patronym honoring the protistologist John O. Corliss. Comparison and phylogenetic analysis of 18S rRNA sequences showed that ''Corlissina maricaensis'' is the sister group to ''Parduczia orbis''. In turn, these two genera form a clade with ''Geleia ''Geleia'' is a genus of karyorelict ciliates in the family Geleiidae. The genus name is a taxonomic patronym honoring the Hungarian protistologist József von Gelei (1885-1952). Systematics 17 species are currently desc ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Karyorelictea
Karyorelictea is a class of ciliates in the subphylum Postciliodesmatophora. Most species are members of the microbenthos community, that is, microscopic organisms found in the marine interstitial habitat, though one genus, ''Loxodes'', is found in freshwater. The majority of karyorelict taxa have not been cultivated in the laboratory, although clonal lines of ''Loxodes'' have been developed. Systematics According to Lynn (2008), the Karyorelictea class is divided into three orders: * Loxodida, containing the families Cryptopharyngidae and Loxodidae; * Protoheterotrichida, containing the families Aveliidae and Geleiidae; * Protostomatida, containing the families Kentrophoridae and Trachelocercidae. These three orders were defined morphologically, and have been confirmed with molecular phylogenetics. An additional family, Wilbertomorphidae, is of uncertain affiliation and has not been assigned to an order. Nuclear dimorphism All ciliates, including karyorelicteans, p ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Karyorelict Nuclear Code
The karyorelictid nuclear code (translation table 27) is a genetic code used by the nuclear genome of the Karyorelictea ciliate ''Parduczia'' sp. The code (27) : AAs = FFLLSSSSYYQQCCWWLLLAPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG : Starts = --------------*--------------------M---------------------------- : Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG : Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG : Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U). Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine ( ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
DNA Codon Table
A codon table can be used to translate a genetic code into a sequence of amino acids. The standard genetic code is traditionally represented as an RNA codon table, because when proteins are made in a Cell (biology), cell by ribosomes, it is messenger RNA (mRNA) that directs protein synthesis. The mRNA sequence is determined by the sequence of genomic DNA. In this context, the standard genetic code is referred to as translation table 1. It can also be represented in a DNA codon table. The DNA codons in such tables occur on the Sense (molecular biology), sense DNA strand and are arranged in a Directionality (molecular biology), 5′-to-3′ direction. Different tables with alternate codons are used depending on the source of the genetic code, such as from a cell nucleus, mitochondrion, plastid, or hydrogenosome. There are 64 different codons in the genetic code and the below tables; most specify an amino acid. Three sequences, UAG, UGA, and UAA, known as stop codons, do not code for ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Nuclear Genome
Nuclear DNA (nDNA), or nuclear deoxyribonucleic acid, is the DNA contained within each cell nucleus of a eukaryotic organism. It encodes for the majority of the genome in eukaryotes, with mitochondrial DNA and plastid DNA coding for the rest. It adheres to Mendelian inheritance, with information coming from two parents, one male and one female—rather than matrilineally (through the mother) as in mitochondrial DNA. Structure Nuclear DNA is a nucleic acid, a polymeric biomolecule or biopolymer, found in the nucleus of eukaryotic cells. Its structure is a double helix, with two strands wound around each other, a structure first described by Francis Crick and James D. Watson (1953) using data collected by Rosalind Franklin. Each strand is a long polymer chain of repeating nucleotides. Each nucleotide is composed of a five-carbon sugar, a phosphate group, and an organic base. Nucleotides are distinguished by their bases: purines, large bases that include adenine and guanine; and pyr ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
List Of Genetic Codes
While there is much commonality, different parts of the tree of life use slightly different genetic codes. When translating from genome to protein, the use of the correct genetic code is essential. The mitochondrial codes are the relatively well-known examples of variation. The list below follows the numbering and designation by NCBI. * Translation table 1: The standard code * Translation table 2: The vertebrate mitochondrial code * Translation table 3: The yeast mitochondrial code * Translation table 4: The mold, protozoan, and coelenterate mitochondrial code and the mycoplasma/spiroplasma code * Translation table 5: The invertebrate mitochondrial code * Translation table 6: The ciliate, dasycladacean and hexamita nuclear code * Translation table 7: The kinetoplast code; ''cf''. table 4. * Translation table 8: ''cf''. table 1. * Translation table 9: The echinoderm and flatworm mitochondrial code * Translation table 10: The euplotid nuclear code * Translation table 11: The ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |