Burrowing Nematode
   HOME
*





Burrowing Nematode
''Radopholus similis'' is a species of nematode known commonly as the burrowing nematode. It is a parasite of plants, and it is a pest of many agricultural crops. It is an especially important pest of bananas and citrus, and it can be found on coconut, avocado, coffee, sugarcane, other grasses, and ornamentals. It is a migratory endoparasite of roots, causing lesions that form cankers. Infected plants experience malnutrition. History and distribution The nematode was first described from necrotic tissue in a species of ''Musa'', the banana genus, in 1891. It is one of the most important root pathogens of banana crops, causing yield losses of up to 30 to 60% in many countries.Banana Nematodes: Pests and Diseases of American Samoa. Number 9.
American Samoa Communi ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Nematode
The nematodes ( or grc-gre, Νηματώδη; la, Nematoda) or roundworms constitute the phylum Nematoda (also called Nemathelminthes), with plant-Parasitism, parasitic nematodes also known as eelworms. They are a diverse animal phylum inhabiting a broad range of environments. Less formally, they are categorized as Helminths, but are taxonomically classified along with Arthropod, arthropods, Tardigrade, tardigrades and other moulting animalia, animals in the clade Ecdysozoa, and unlike platyhelminthe, flatworms, have tubular digestion, digestive systems with openings at both ends. Like tardigrades, they have a reduced number of Hox genes, but their sister phylum Nematomorpha has kept the ancestral protostome Hox genotype, which shows that the reduction has occurred within the nematode phylum. Nematode species can be difficult to distinguish from one another. Consequently, estimates of the number of nematode species described to date vary by author and may change rapidly over ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Temperate Climate
In geography, the temperate climates of Earth occur in the middle latitudes (23.5° to 66.5° N/S of Equator), which span between the tropics and the polar regions of Earth. These zones generally have wider temperature ranges throughout the year and more distinct seasonal changes compared to tropical climates, where such variations are often small and usually only have precipitation changes. In temperate climates, not only do latitudinal positions influence temperature changes, but sea currents, prevailing wind direction, continentality (how large a landmass is) and altitude also shape temperate climates. The Köppen climate classification defines a climate as "temperate" C, when the mean temperature is above but below in the coldest month to account for the persistency of frost. However, other climate classifications set the minimum at . Zones and climates The north temperate zone extends from the Tropic of Cancer (approximately 23.5° north latitude) to the Arctic ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Banana Diseases
This article is a list of diseases of bananas and plantains (''Musa'' spp.). Bacterial diseases Fungal diseases Viral diseases Nematodes, parasitic Miscellaneous diseases and disorders References Common Names of Diseases, The American Phytopathological Society {{Banana Banana A banana is an elongated, edible fruit – botanically a berry – produced by several kinds of large herbaceous flowering plants in the genus ''Musa''. In some countries, bananas used for cooking may be called "plantains", distinguis ... ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


Agricultural Pest Nematodes
280px, Feeding types of plant-parasitic nematodes This article is an attempt to list all agricultural pest nematodes. Species are sorted in alphabetical order of Latin name. A * '' Achlysiella williamsi'' * ''Anguina agrostis'' * ''Anguina amsinckiae'' * ''Anguina australis'' * '' Anguina balsamophila'' * ''Anguina funesta'' * ''Anguina graminis'' * ''Anguina spermophaga'' * ''Anguina tritici'' * ''Aphelenchoides arachidis'' * ''Aphelenchoides besseyi'' * ''Aphelenchoides fragariae'' * ''Aphelenchoides parietinus'' * ''Aphelenchoides ritzemabosi'' * ''Aphelenchoides subtenuis'' B * '' Belonolaimus gracilis'' * '' Belonolaimus longicaudatus'' C * '' Craspedonema elegans'' D * ''Ditylenchus africanus'' * ''Ditylenchus angustus'' * ''Ditylenchus destructor'' * ''Ditylenchus dipsaci'' * ''Dolichodorus heterocephalus'' G * ''Globodera pallida'' * ''Globodera rostochiensis'' * ''Globodera tabacum'' H * ''Helicotylenchus dihystera'' * ''Hemicriconemoides kanayaensis'' * ' ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Nematodes Described In 1949
The nematodes ( or grc-gre, Νηματώδη; la, Nematoda) or roundworms constitute the phylum Nematoda (also called Nemathelminthes), with plant-parasitic nematodes also known as eelworms. They are a diverse animal phylum inhabiting a broad range of environments. Less formally, they are categorized as Helminths, but are taxonomically classified along with arthropods, tardigrades and other moulting animals in the clade Ecdysozoa, and unlike flatworms, have tubular digestive systems with openings at both ends. Like tardigrades, they have a reduced number of Hox genes, but their sister phylum Nematomorpha has kept the ancestral protostome Hox genotype, which shows that the reduction has occurred within the nematode phylum. Nematode species can be difficult to distinguish from one another. Consequently, estimates of the number of nematode species described to date vary by author and may change rapidly over time. A 2013 survey of animal biodiversity published in the mega journal ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


Tylenchida
Tylenchida is an order of nematodes. List of families * Superfamily Criconematoidea ** Family Criconematidae ** Family Tylenchulidae * Superfamily Tylenchoidea ** Family Anguinidae ** Family Belonolaimidae ** Family Dolichodoridae ** Family Ecphyadophoridae ** Family Hoplolaimidae ** Family Heteroderidae ** Family Pratylenchidae ** Family Tylenchidae * Superfamily Sphaerularina ** Family Allantonematidae Allantonematidae is a family of insect-parasitic nematodes from the order Tylenchida. Allantonematid nematodes infect a variety of insects including beetles, butterflies, flies, thrips, ants, and more. For instance, the nematode ''Howardula aoron ... ** Family Fergusobiidae ** Family Iotonchiidae ** Family Parasitylenchidae ** Family Sphaerulariidae References Further reading * Mohammad Rafiq Siddiqui. ''Tylenchida: Parasites of Plants and Insects''. 2nd ed. Wallingford: CABI Publishing, 2000. External l ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


The Alternative Flatworm Mitochondrial Code
The alternative flatworm mitochondrial code (translation table 14) is a genetic code found in the mitochondria of Platyhelminthes and Nematodes. Code :    AAs = FFLLSSSSYYY*CCWWLLLLPPPPHHQQRRRRIIIMTTTTNNNKSSSSVVVVAAAADDEEGGGG : Starts = -----------------------------------M---------------------------- :  Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG : Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG : Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U). Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Trypt ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  




Radopholus Arabocoffeae
''Radopholus arabocoffeae'' is a nematode in the genus ''Radopholus''. It is notable as an early example, along with ''Radopholus similis'', of the alternative flatworm mitochondrial code The alternative flatworm mitochondrial code (translation table 14) is a genetic code found in the mitochondria of Platyhelminthes and Nematodes. Code :    AAs = FFLLSSSSYYY*CCWWLLLLPPPPHHQQRRRRIIIMTTTTNNNKSSSSVVVVAAAADDEEGGGG : S .... References {{Taxonbar, from=Q25346369 Tylenchida ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Tagetes
''Tagetes'' () is a genusSoule, J. A. 1996. Infrageneric Systematics of Tagetes. Pgs. 435-443 in Compositae: Systematics, Proceedings of the International Compositae Conference, Kew 1994, Vol. I, Eds. D.J.N. Hind & H.J. Beentje. of annual or perennial, mostly herbaceous plants in the family Asteraceae. They are among several groups of plants known in English as marigolds. The genus ''Tagetes'' was described by Carl Linnaeus in 1753. These plants are native to Mexico, growing naturally since Mexico's valley down to the south and even reaching several other Latinamerican countries, but some species have become naturalized around the world. One species, '' T. minuta'', is considered a noxious invasive plant in some areas. Description ''Tagetes'' species vary in size from 0.1 to 2.2 m tall. Most species have pinnate green leaves. Blooms naturally occur in golden, orange, yellow, and white colors, often with maroon highlights. Floral heads are typically (1-) to 4–6 cm ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Crotalaria
''Crotalaria'' is a genus of flowering plants in the family Fabaceae (subfamily Faboideae) commonly known as rattlepods. The genus includes over 700 species of herbaceous plants and shrubs. Africa is the continent with the majority of ''Crotalaria'' species (approximately 400 species), which are mainly found in damp grassland, especially in floodplains, depressions and along edges of swamps and rivers, but also in deciduous bush land, roadsides and fields. Some species of ''Crotalaria'' are grown as ornamentals. The common name rattlepod or rattlebox is derived from the fact that the seeds become loose in the pod as they mature, and rattle when the pod is shaken. The name derives from the Ancient Greek , meaning " castanet", and is the same root as the name for the rattlesnakes (''Crotalus''). ''Crotalaria'' species are used as food plants by the larvae of some Lepidoptera species including ''Endoclita sericeus'', ''Etiella zinckenella'' and ''Utetheisa ornatrix''. The toxic al ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Cover Crop
In agriculture, cover crops are plants that are planted to cover the soil rather than for the purpose of being harvested. Cover crops manage soil erosion, soil fertility, soil quality, water, weeds, pests, diseases, biodiversity and wildlife in an agroecosysteman ecological system managed and shaped by humans. Cover crops may be an off-season crop planted after harvesting the cash crop. They may grow over winter. Cover crops are nurse crops in that they increase the survival of the main crop being harvested. Soil erosion Although cover crops can perform multiple functions in an agroecosystem simultaneously, they are often grown for the sole purpose of preventing soil erosion. Soil erosion is a process that can irreparably reduce the productive capacity of an agroecosystem. Cover crops reduce soil loss by improving soil structure and increasing infiltration, protecting the soil surface, scattering raindrop energy and reducing the velocity of the movement of water over the so ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


Crop Rotation
Crop rotation is the practice of growing a series of different types of crops in the same area across a sequence of growing seasons. It reduces reliance on one set of nutrients, pest and weed pressure, and the probability of developing resistant pests and weeds. Growing the same crop in the same place for many years in a row, known as monocropping, gradually depletes the soil of certain nutrients and selects for a highly competitive pest and weed community. Without balancing nutrient use and diversifying pest and weed communities, the productivity of monocultures is highly dependent on external inputs. Conversely, a well-designed crop rotation can reduce the need for synthetic fertilizers and herbicides by better using ecosystem services from a diverse set of crops. Additionally, crop rotations can improve soil structure and organic matter, which reduces erosion and increases farm system resilience. History Agriculturalists have long recognized that suitable rotations — such ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]