Radopholus Arabocoffeae

	Radopholus Arabocoffeae ''Radopholus arabocoffeae'' is a nematode in the genus ''Radopholus''. It is notable as an early example, along with ''Radopholus similis'', of the alternative flatworm mitochondrial code The alternative flatworm mitochondrial code (translation table 14) is a genetic code found in the mitochondria of Platyhelminthes and Nematodes. Code : AAs = FFLLSSSSYYYCCWWLLLLPPPPHHQQRRRRIIIMTTTTNNNKSSSSVVVVAAAADDEEGGGG : S .... References {{Taxonbar, from=Q25346369 Tylenchida ... [...More Info...] [...Related Items...] OR:* [Wikipedia] [Google] [Baidu]
picture info	Animal Animals are multicellular, eukaryotic organisms in the Kingdom (biology), biological kingdom Animalia. With few exceptions, animals Heterotroph, consume organic material, Cellular respiration#Aerobic respiration, breathe oxygen, are Motility, able to move, can Sexual reproduction, reproduce sexually, and go through an ontogenetic stage in which their body consists of a hollow sphere of Cell (biology), cells, the blastula, during Embryogenesis, embryonic development. Over 1.5 million Extant taxon, living animal species have been Species description, described—of which around 1 million are Insecta, insects—but it has been estimated there are over 7 million animal species in total. Animals range in length from to . They have Ecology, complex interactions with each other and their environments, forming intricate food webs. The scientific study of animals is known as zoology. Most living animal species are in Bilateria, a clade whose members have a Symmetry in biology#Bilate ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu]
picture info	Nematode The nematodes ( or grc-gre, Νηματώδη; la, Nematoda) or roundworms constitute the phylum Nematoda (also called Nemathelminthes), with plant-Parasitism, parasitic nematodes also known as eelworms. They are a diverse animal phylum inhabiting a broad range of environments. Less formally, they are categorized as Helminths, but are taxonomically classified along with Arthropod, arthropods, Tardigrade, tardigrades and other moulting animalia, animals in the clade Ecdysozoa, and unlike platyhelminthe, flatworms, have tubular digestion, digestive systems with openings at both ends. Like tardigrades, they have a reduced number of Hox genes, but their sister phylum Nematomorpha has kept the ancestral protostome Hox genotype, which shows that the reduction has occurred within the nematode phylum. Nematode species can be difficult to distinguish from one another. Consequently, estimates of the number of nematode species described to date vary by author and may change rapidly over ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu]
	Secernentea Secernentea was a class of nematodes in the Classical Phylogeny System (Chitwood, 1958) and is no longer in use. This morphological-based classification system has been replaced by the Modern Phylogeny system, where taxonomy assignment is based on small subunit ribosomal DNA (SSU rDNA). Characteristics of Secernentea are: * Amphid apertures are pore/slit-like * Derids are present in some; located near nerve ring * Phasmids are present; posterior * Excretory system is tubular * Cuticle is striated in two to four layers; lateral field is present * Three esophageal glands; esophageal structure varies * Males generally have one testis * Caudal alae are common * Sensory papillae are cephalic only; may be caudal papillae in males * Mostly terrestrial * Rarely found in fresh or marine water Systematics Subclasses and orders of Secernentea are:Tree of Life Web Project (ToL) (2002)Nematoda. Version of January 1, 2002. Retrieved November 2, 2008. * Subclass Rhabditia (paraphyletic?) ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu]
	Diplogasteria Diplogasterida was an order of nematodes. It was sometimes placed in a monotypic subclass Diplogasteria, but molecular phylogenetic evidence has shown it to be embedded in the family Rhabditidae (formerly Rhabditina). The confusion of having a hierarchical nesting of groups that were formerly mutually exclusive has led to a profusion of names. Although completely revised taxonomy of nematodes that builds on recent classification systems as well as recent phylogenetic evidence is still necessary, most contemporary taxonomic studies now treat all groups listed under "Diplogasterina" below as a single family, Diplogastridae. Subdivisions Suborder Chambersiellina Hodda 2007 Superfamily Chambersielloidea Thorne 1937 *Family Chambersiellidae Thorne 1937 (Sanwal 1957) Suborder Diplogasterina Paramonov 1952 Superfamily Cylindrocorporoidea T. Goodey 1939 Family Cylindrocorporidae T. Goodey 1939 Family Odontopharyngidae Micoletzky 1922 Superfamily Diplogasteroid ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu]
	Tylenchida Tylenchida is an order of nematodes. List of families * Superfamily Criconematoidea Family Criconematidae Family Tylenchulidae * Superfamily Tylenchoidea Family Anguinidae Family Belonolaimidae Family Dolichodoridae Family Ecphyadophoridae Family Hoplolaimidae Family Heteroderidae Family Pratylenchidae Family Tylenchidae Tylenchidae is a family of nematode The nematodes ( or grc-gre, Νηματώδη; la, Nematoda) or roundworms constitute the phylum Nematoda (also called Nemathelminthes), with plant- parasitic nematodes also known as eelworms. They are a ... * Superfamily Sphaerularina Family Allantonematidae Family Fergusobiidae Family Iotonchiidae Family Parasitylenchidae ** Family Sphaerulariidae References Further reading * Mohammad Rafiq Siddiqui. ''Tylenchida: Parasites of Plants and Insects''. 2nd ed. Wallingford: CABI Publishing, 2000. Ex ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu]
	Pratylenchidae Pratylenchidae is a family Family (from la, familia) is a group of people related either by consanguinity (by recognized birth) or affinity (by marriage or other relationship). The purpose of the family is to maintain the well-being of its members and of society. Idea ... of plant pathogenic nematodes. Members include Achlysiella williamsi. References Tylenchida Nematode families Taxa described in 1949 {{plant-disease-stub ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu]
	Radopholus ''Radopholus'' is a genus of nematodes belonging to the family Pratylenchidae. The genus has almost cosmopolitan distribution. Species: '' Radopholus arabocoffeae'' '' Radopholus bridgei'' '' Radopholus cavenessi'' '' Radopholus citri'' '' Radopholus clarus'' '' Radopholus colbrani'' '' Radopholus crenatus'' '' Radopholus daklakensis'' '' Radopholus duriophilus'' '' Radopholus inaequalis'' '' Radopholus inanis'' '' Radopholus inequalis'' '' Radopholus intermedius'' '' Radopholus kahikateae'' '' Radopholus megadorus'' '' Radopholus musicola'' '' Radopholus nativus'' '' Radopholus nelsonensis'' '' Radopholus neosimilis'' '' Radopholus rectus'' '' Radopholus rotundisemenus'' '' Radopholus serratus'' ''Radopholus similis ''Radopholus similis'' is a species of nematode known commonly as the burrowing nematode. It is a parasite of plants, and it is a pest of many agricultural crops. It is an especially important pest of bananas and cit ... [...More Info...] [...Related Items...] OR:* [Wikipedia] [Google] [Baidu]
	Radopholus Similis ''Radopholus similis'' is a species of nematode known commonly as the burrowing nematode. It is a parasite of plants, and it is a pest of many agricultural crops. It is an especially important pest of bananas and citrus, and it can be found on coconut, avocado, coffee, sugarcane, other grasses, and ornamentals. It is a migratory endoparasite of roots, causing lesions that form cankers. Infected plants experience malnutrition. History and distribution The nematode was first described from necrotic tissue in a species of ''Musa'', the banana genus, in 1891. It is one of the most important root pathogens of banana crops, causing yield losses of up to 30 to 60% in many countries.Banana Nematodes: Pests and Diseases of American Samoa. Number 9. American Samoa Co ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu]
	The Alternative Flatworm Mitochondrial Code The alternative flatworm mitochondrial code (translation table 14) is a genetic code found in the mitochondria of Platyhelminthes and Nematodes. Code : AAs = FFLLSSSSYYYCCWWLLLLPPPPHHQQRRRRIIIMTTTTNNNKSSSSVVVVAAAADDEEGGGG : Starts = -----------------------------------M---------------------------- : Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG : Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG : Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U). Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Trypt ... [...More Info...] [...Related Items...] OR:* [Wikipedia] [Google] [Baidu]
	National Center For Biotechnology Information The National Center for Biotechnology Information (NCBI) is part of the United States National Library of Medicine (NLM), a branch of the National Institutes of Health (NIH). It is approved and funded by the government of the United States. The NCBI is located in Bethesda, Maryland, and was founded in 1988 through legislation sponsored by US Congressman Claude Pepper. The NCBI houses a series of databases relevant to biotechnology and biomedicine and is an important resource for bioinformatics tools and services. Major databases include GenBank for DNA sequences and PubMed, a bibliographic database for biomedical literature. Other databases include the NCBI Epigenomics database. All these databases are available online through the Entrez search engine. NCBI was directed by David Lipman, one of the original authors of the BLAST sequence alignment program and a widely respected figure in bioinformatics. GenBank NCBI had responsibility for making available the GenBank DNA seque ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu]