HOME
*





Ivor Royston
Ivor Royston, M.D., is an oncologist, researcher, scientist, entrepreneur and venture capitalist, recognized for his efforts to develop treatments for multiple disease targets and to fund biotechnology companies with promising science, technology or medicines.Fikes, Bradley J. ''Only time eludes forever quizzical science maverick: Ivor Royston, president of San Diego Regional Cancer Center,'' ''San Diego Business Journal,'' June 13, 1994."Why San Diego Has Biotech"
, Fikes, Bradley J. ''San Diego Metropolitan,'' April 1999. Accessed June 20, 2008.

Wilson, Elizabeth K. ''Chemical & Engineering News,'' March 5, 2001. Accessed June 20, 2008.

[...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

England
England is a country that is part of the United Kingdom. It shares land borders with Wales to its west and Scotland to its north. The Irish Sea lies northwest and the Celtic Sea to the southwest. It is separated from continental Europe by the North Sea to the east and the English Channel to the south. The country covers five-eighths of the island of Great Britain, which lies in the North Atlantic, and includes over 100 smaller islands, such as the Isles of Scilly and the Isle of Wight. The area now called England was first inhabited by modern humans during the Upper Paleolithic period, but takes its name from the Angles, a Germanic tribe deriving its name from the Anglia peninsula, who settled during the 5th and 6th centuries. England became a unified state in the 10th century and has had a significant cultural and legal impact on the wider world since the Age of Discovery, which began during the 15th century. The English language, the Anglican Church, and Eng ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


Kleiner Perkins Caufield & Byers
Kleiner Perkins, formerly Kleiner Perkins Caufield & Byers (KPCB), is an American venture capital firm which specializes in investing in incubation, early stage and growth companies. Since its founding in 1972, the firm has backed entrepreneurs in over 900 ventures,"Assets"
Kleiner Perkins, 2019
including , Amazon.com, Tandem Computers, ,

Hybritech Progeny Chart
Beckman Coulter Inc. is a Danaher Corporation company that develops, manufactures, and markets products that simplify, automate and innovate complex biomedical testing. It operates in two industries: Diagnostics and Life Sciences. For more than 80 years, Beckman Coulter Inc. has helped healthcare and laboratory professionals, pharmaceutical and biotechnology companies, universities, medical schools, and research institutions worldwide. The company eventually grew to employ over 12,000 people, with $5.8 billion in annual sales by 2017. It is currently headquartered in Brea, California. Beckman Coulter was acquired by Danaher Corporation in 2011. History Founded by Caltech professor Arnold O. Beckman in 1935 as National Technical Laboratories to commercialize a pH meter that he had invented. In the 1940s, Beckman changed the name to Arnold O. Beckman, Inc. to sell oxygen analyzers, the ''Helipot'' precision potentiometer, and spectrophotometers. In the 1950s, the company name c ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  




Ligand Pharmaceuticals
Ligand Pharmaceuticals is a biopharmaceutical company located in San Diego, California. Founded in 1987 as Progenix Inc., the company went public in 1992. Initially focused on developing its own drugs, a period of turbulence in the early 2000s culminated in its CEO being ejected by the shareholders and provoked a change in focus to the acquisition of existing drugs and forming partnerships to develop them further. The company has been the subject of multiple regulatory investigations, negative shorts-seller reports and class action lawsuits amid allegations of securities fraud. In 2018 its CEO was listed among the top five highest paid CEOs in San Diego. Business Ligand Pharmaceutical develops or acquires royalty-generating assets comprising numerous technologies, therapies and drugs. The drugs for which it receives royalties include Kyprolis, Promacta, Melphalan and Baxdela. As of 2015, Ligand Pharmaceuticals was partnered with approximately 120 pharmaceutical companies, wh ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


Gen-Probe
Gen-Probe was a company based in San Diego, in California, specializing in clinical diagnostics, blood screening, transplantation products and research products. The company's molecular diagnostics products were used for diagnosis of infectious diseases, blood screening, analyzing blood transfusions for immune response, testing coagulation pathways, and organ transplantation viability. Their products and services also included technology and know-how in biomedical research and drug development Drug development is the process of bringing a new pharmaceutical drug to the market once a lead compound has been identified through the process of drug discovery. It includes preclinical research on microorganisms and animals, filing for r .... The merger On 1 August 2012, Gen-Probe merged with Hologic. References {{reflist External links Official website Companies formerly listed on the Nasdaq ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


Amylin
Amylin, or islet amyloid polypeptide (IAPP), is a 37-residue peptide hormone. It is co-secreted with insulin from the pancreatic β-cells in the ratio of approximately 100:1 (insulin:amylin). Amylin plays a role in glycemic regulation by slowing gastric emptying and promoting satiety, thereby preventing post-prandial spikes in blood glucose levels. IAPP is processed from an 89-residue coding sequence. Proislet amyloid polypeptide (proIAPP, proamylin, proislet protein) is produced in the pancreatic beta cells (β-cells) as a 67 amino acid, 7404 Dalton pro-peptide and undergoes post-translational modifications including protease cleavage to produce amylin. Synthesis ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLN ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Rituxan
Rituximab, sold under the brand name Rituxan among others, is a monoclonal antibody medication used to treat certain autoimmune diseases and types of cancer. It is used for non-Hodgkin lymphoma, chronic lymphocytic leukemia (in non-geriatric patients), rheumatoid arthritis, granulomatosis with polyangiitis, idiopathic thrombocytopenic purpura, pemphigus vulgaris, myasthenia gravis and Epstein–Barr virus-positive mucocutaneous ulcers. It is given by slow injection into a vein. Biosimilars of Rituxan include Blitzima, Riabni, Ritemvia, Rituenza (F.K.A. Tuxella), Rixathon, Ruxience, and Truxima. Common side effects which often occur within two hours of the medication being given include rash, itchiness, low blood pressure, and shortness of breath. Infections are also common. Severe side effects include reactivation of hepatitis B in those previously infected, progressive multifocal leukoencephalopathy, toxic epidermal necrolysis, and death. It is unclear if use during pregnanc ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  




Chapter 11, Title 11, United States Code
Chapter 11 of the United States Bankruptcy Code ( Title 11 of the United States Code) permits reorganization under the bankruptcy laws of the United States. Such reorganization, known as Chapter 11 bankruptcy, is available to every business, whether organized as a corporation, partnership or sole proprietorship, and to individuals, although it is most prominently used by corporate entities. In contrast, Chapter 7 governs the process of a liquidation bankruptcy, though liquidation may also occur under Chapter 11; while Chapter 13 provides a reorganization process for the majority of private individuals. Chapter 11 overview When a business is unable to service its debt or pay its creditors, the business or its creditors can file with a federal bankruptcy court for protection under either Chapter 7 or Chapter 11. In Chapter 7, the business ceases operations, a trustee sells all of its assets, and then distributes the proceeds to its creditors. Any residual amount is returned ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Brook Byers
Brook Byers (born August 2, 1945, Belleville, IL (Scott Air Force Base)) is a senior partner at Kleiner Perkins Caufield & Byers and the brother of Stanford University Professor Tom Byers and Atlanta, Georgia engineering entrepreneur Ken Byers. Early life and education Raised in Atlanta, Georgia, Byers earned a bachelor's degree in electrical engineering in 1968 from Georgia Tech and an MBA from Stanford University. Career Brook Byers has been a venture capital investor since 1972. He has been closely involved with more than fifty new technology based ventures, over half of which have already become public companies. He formed the first Life Sciences practice group in the venture capital profession in 1984 and led KPCB to become a top tier venture capital firm in the medical, healthcare, and biotechnology sectors. KPCB has invested in and helped build over 110 Life Sciences companies which have already developed hundreds of products to treat major underserved medical needs for ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


Biogen Idec
Biogen Inc. is an American multinational biotechnology company based in Cambridge, Massachusetts, specializing in the discovery, development, and delivery of therapies for the treatment of neurological diseases to patients worldwide. History Biogen was founded in 1978 in Geneva as ''Biotechnology Geneva'' by several prominent biologists, including Kenneth Murray from the University of Edinburgh, Phillip Allen Sharp from the Massachusetts Institute of Technology, Walter Gilbert from Harvard University (Gilbert served as CEO during the start-up phase of Biogen), Heinz Schaller from the University of Heidelberg, and Charles Weissmann from the University of Zurich (Weissmann contributed the first product interferon alpha).Werner Grundlehner''Zürcher Antikörper gegen Alzheimer hat Milliardenpotenzial – und Gegenwind.''Neue Zürcher Zeitung, June 8, 2021. Retrieved June 8, 2021. Gilbert and Sharp were subsequently honored with Nobel Prizes: Gilbert was recognized in 1980 with ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]