|
Loxodes Magnus
''Loxodes'' is a genus of karyorelictean ciliates, belonging to family Loxodidae. It is the only known karyorelictean ciliate that lives in freshwater habitats. The term ''Loxodes'' derives from the ancient greek (), meaning "oblique, tilted". Ecology ''Loxodes'' lives in freshwater habitats such as lakes and ponds, unlike other karyorelictean ciliates such as the other loxodid genus ''Remanella'', which live in brackish-water or marine habitats. They feed on bacteria and protists such as microalgae. It is microaerobic, preferring low concentrations of oxygen, below 5% atmospheric saturation. It can also survive extended periods in anoxic water, where oxygen is absent. Under such conditions, ''Loxodes'' is able to use nitrate instead of oxygen as an electron acceptor for respiration. Nitrate respiration is rare among eukaryotes, and ''Loxodes'' was the first eukaryote known to have this capability. ''Loxodes'' is also sensitive to light. Geotaxis Both genera in the family ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Loxodes Magnus
''Loxodes'' is a genus of karyorelictean ciliates, belonging to family Loxodidae. It is the only known karyorelictean ciliate that lives in freshwater habitats. The term ''Loxodes'' derives from the ancient greek (), meaning "oblique, tilted". Ecology ''Loxodes'' lives in freshwater habitats such as lakes and ponds, unlike other karyorelictean ciliates such as the other loxodid genus ''Remanella'', which live in brackish-water or marine habitats. They feed on bacteria and protists such as microalgae. It is microaerobic, preferring low concentrations of oxygen, below 5% atmospheric saturation. It can also survive extended periods in anoxic water, where oxygen is absent. Under such conditions, ''Loxodes'' is able to use nitrate instead of oxygen as an electron acceptor for respiration. Nitrate respiration is rare among eukaryotes, and ''Loxodes'' was the first eukaryote known to have this capability. ''Loxodes'' is also sensitive to light. Geotaxis Both genera in the family ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Müllerian Vesicle
Loxodidae is a family of karyorelict ciliates. Loxodidae members possess an elongated, laterally flattened shape. They share two key characters: a beak-like anterior rostrum interrupting the perioral kineties, and peculiar cytoplasmic organelles named Müller vesicles. The extensive development of lacunae of the smooth endoplasmic reticulum leads to strong vacuolization of the endoplasm. This feature is associated to a lack of contractile vacuoles in all loxodids. The term ''Loxodidae'' derives from the ancient Greek (), meaning "oblique, tilted". Gravitaxis Loxodidae members possess the ability to orient themselves in oxygen gradients. They use gravity as a stimulus for this spatial orientation, a phenomenon called gravitaxis or geotaxis. Loxodid ciliates must therefore have developed mechanoreceptors informing them about what is up or down. A likely candidate structure for their gravitaxis is the Müller vesicle. Müller vesicle Müller vesicles (also known as Müller ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Diploid
Ploidy () is the number of complete sets of chromosomes in a cell, and hence the number of possible alleles for autosomal and pseudoautosomal genes. Sets of chromosomes refer to the number of maternal and paternal chromosome copies, respectively, in each homologous chromosome pair, which chromosomes naturally exist as. Somatic cells, tissues, and individual organisms can be described according to the number of sets of chromosomes present (the "ploidy level"): monoploid (1 set), diploid (2 sets), triploid (3 sets), tetraploid (4 sets), pentaploid (5 sets), hexaploid (6 sets), heptaploid or septaploid (7 sets), etc. The generic term polyploid is often used to describe cells with three or more chromosome sets. Virtually all sexually reproducing organisms are made up of somatic cells that are diploid or greater, but ploidy level may vary widely between different organisms, between different tissues within the same organism, and at different stages in an organism's life cycle. Half ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
DNA Synthesis
DNA synthesis is the natural or artificial creation of deoxyribonucleic acid (DNA) molecules. DNA is a macromolecule made up of nucleotide units, which are linked by covalent bonds and hydrogen bonds, in a repeating structure. DNA synthesis occurs when these nucleotide units are joined to form DNA; this can occur artificially (''in vitro'') or naturally (''in vivo''). Nucleotide units are made up of a nitrogenous base (cytosine, guanine, adenine or thymine), pentose sugar (deoxyribose) and phosphate group. Each unit is joined when a covalent bond forms between its phosphate group and the pentose sugar of the next nucleotide, forming a sugar-phosphate backbone. DNA is a complementary, double stranded structure as specific base pairing (adenine and thymine, guanine and cytosine) occurs naturally when hydrogen bonds form between the nucleotide bases. There are several different definitions for DNA synthesis: it can refer to DNA replication - DNA biosynthesis (''in vivo'' DNA amplific ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Otto Bütschli
Johann Adam Otto Bütschli (3 May 1848 – 2 February 1920) was a German zoologist and professor at the University of Heidelberg. He specialized in invertebrates and insect development. Many of the groups of protists were first recognized by him. Life Bütschli was born Frankfurt am Main. He studied mineralogy, chemistry, and paleontology in Karlsruhe and became assistant of Karl Alfred von Zittel (geology and paleontology). He moved to Heidelberg in 1866 and worked with Robert Bunsen (chemistry). He received his PhD from the University of Heidelberg in 1868, after passing examinations in geology, paleontology, and zoology. He joined Rudolf Leuckart at the University of Leipzig in 1869. After leaving his studies to serve as an officer in the Franco-Prussian War (1870–1871), Bütschli worked in his private laboratory and then for two years (1873–1874) with Karl Möbius at the University of Kiel. After that, he worked privately. In 1876, he made Habilitation. He became prof ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Ciliate, Dasycladacean And Hexamita Nuclear Code
The ciliate, dasycladacean and ''Hexamita'' nuclear code (translation table 6) is a genetic code used by certain ciliate, dasycladacean and ''Hexamita'' species. The ciliate macronuclear code has not been determined completely. The codon UAA is known to code for Gln only in the Oxytrichidae. The code : AAs = FFLLSSSSYYQQCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG : Starts = -----------------------------------M---------------------------- : Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG : Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG : Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U). Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleuc ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Glutamine
Glutamine (symbol Gln or Q) is an α-amino acid that is used in the biosynthesis of proteins. Its side chain is similar to that of glutamic acid, except the carboxylic acid group is replaced by an amide. It is classified as a charge-neutral, polar amino acid. It is non-essential and conditionally essential in humans, meaning the body can usually synthesize sufficient amounts of it, but in some instances of stress, the body's demand for glutamine increases, and glutamine must be obtained from the diet. It is encoded by the codons CAA and CAG. In human blood, glutamine is the most abundant free amino acid. The dietary sources of glutamine include especially the protein-rich foods like beef, chicken, fish, dairy products, eggs, vegetables like beans, beets, cabbage, spinach, carrots, parsley, vegetable juices and also in wheat, papaya, Brussels sprouts, celery, kale and fermented foods like miso. Functions Glutamine plays a role in a variety of biochemical functions: * Pr ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Genetic Code
The genetic code is the set of rules used by living cells to translate information encoded within genetic material ( DNA or RNA sequences of nucleotide triplets, or codons) into proteins. Translation is accomplished by the ribosome, which links proteinogenic amino acids in an order specified by messenger RNA (mRNA), using transfer RNA (tRNA) molecules to carry amino acids and to read the mRNA three nucleotides at a time. The genetic code is highly similar among all organisms and can be expressed in a simple table with 64 entries. The codons specify which amino acid will be added next during protein biosynthesis. With some exceptions, a three-nucleotide codon in a nucleic acid sequence specifies a single amino acid. The vast majority of genes are encoded with a single scheme (see the RNA codon table). That scheme is often referred to as the canonical or standard genetic code, or simply ''the'' genetic code, though variant codes (such as in mitochondria) exist. History Effor ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Cyanobacteria
Cyanobacteria (), also known as Cyanophyta, are a phylum of gram-negative bacteria that obtain energy via photosynthesis. The name ''cyanobacteria'' refers to their color (), which similarly forms the basis of cyanobacteria's common name, blue-green algae, although they are not usually scientifically classified as algae. They appear to have originated in a freshwater or terrestrial environment. Sericytochromatia, the proposed name of the paraphyletic and most basal group, is the ancestor of both the non-photosynthetic group Melainabacteria and the photosynthetic cyanobacteria, also called Oxyphotobacteria. Cyanobacteria use photosynthetic pigments, such as carotenoids, phycobilins, and various forms of chlorophyll, which absorb energy from light. Unlike heterotrophic prokaryotes, cyanobacteria have internal membranes. These are flattened sacs called thylakoids where photosynthesis is performed. Phototrophic eukaryotes such as green plants perform photosynthesis in plast ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Gravitaxis
Gravitaxis (or ''geotaxis'') is a form of taxis characterized by the directional movement of an organism in response to gravity. Gravitaxis is one of the many forms of taxis. It is characterized by the movement of an organism in response to gravitational forces. It is sometimes called geotaxis. There are a few different causes for gravitaxis. Many microorganisms have receptors like statocysts that allow them to sense the direction of gravity and to adjust their orientation accordingly. However, gravitaxis can result also from a purely physical mechanism so that organs for sensing the direction of gravity are not necessary. An example is given by microorganisms with a center of mass that is shifted to one end of the organism. Similar to a buoy, such mass-anisotropic microorganisms orient upwards under gravity. It has been shown that even an asymmetry in the shape of microorganisms can be sufficient to cause gravitaxis. Gravitaxis is different from gravitropism in a way that the latt ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Geotaxis
Gravitaxis (or ''geotaxis'') is a form of taxis characterized by the directional movement of an organism in response to gravity. Gravitaxis is one of the many forms of taxis. It is characterized by the movement of an organism in response to gravitational forces. It is sometimes called geotaxis. There are a few different causes for gravitaxis. Many microorganisms have receptors like statocysts that allow them to sense the direction of gravity and to adjust their orientation accordingly. However, gravitaxis can result also from a purely physical mechanism so that organs for sensing the direction of gravity are not necessary. An example is given by microorganisms with a center of mass that is shifted to one end of the organism. Similar to a buoy, such mass-anisotropic microorganisms orient upwards under gravity. It has been shown that even an asymmetry in the shape of microorganisms can be sufficient to cause gravitaxis. Gravitaxis is different from gravitropism in a way that the latt ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Statocyst
The statocyst is a balance sensory receptor present in some aquatic invertebrates, including bivalves, cnidarians, ctenophorans, echinoderms, cephalopods, and crustaceans. A similar structure is also found in ''Xenoturbella''. The statocyst consists of a sac-like structure containing a mineralised mass (statolith) and numerous innervated sensory hairs (setae). The statolith's inertia causes it to push against the setae when the animal accelerates. Deflection of setae by the statolith in response to gravity activates neurons, providing feedback to the animal on change in orientation and allowing balance to be maintained. In other words, the statolith shifts as the animal moves. Any movement large enough to throw the organism off balance causes the statolith to brush against tiny bristles which in turn send a message to the brain to correct its balance. It may have been present in the common ancestor of cnidarians and bilaterians. Hearing In cephalopods like squids, statocysts ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
