|
Joel Habener
Joel Habener is a Professor of Medicine at Harvard Medical School. Habener worked with Svetlana Mojsov on elucidating the role of incretin hormones such as Glucagon-like peptide-1 (GLP-1) and Glucagon-like peptide-2 (GLP-2). Habener received credit for the work on hormones when Mosjov was not credited. Habener was awarded the 2020 Warren Alpert Foundation Prize along with Daniel Drucker and Jens Juul Holst. He was elected to the National Academy of Sciences in 2020. In 2021 he was awarded the Canada Gairdner International Award. In 2023, he received the VinFuture Prize The VinFuture Prize is an annual international award that honors remarkable scientific breakthroughs and promotes innovations for mankind, with involvement from world-renowned scientists, policymakers, business leaders, and Prize holders. It is t .... References Harvard Medical School staff Medical researchers Members of the United States National Academy of Sciences Living people Year of birth missin ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Harvard Medical School
Harvard Medical School (HMS) is the graduate medical school of Harvard University and is located in the Longwood Medical Area of Boston, Massachusetts. Founded in 1782, HMS is one of the oldest medical schools in the United States and is consistently ranked first for research among medical schools by '' U.S. News & World Report''. Unlike most other leading medical schools, HMS does not operate in conjunction with a single hospital but is directly affiliated with several teaching hospitals in the Boston area. Affiliated teaching hospitals and research institutes include Dana–Farber Cancer Institute, Massachusetts General Hospital, Brigham and Women's Hospital, Beth Israel Deaconess Medical Center, Boston Children's Hospital, McLean Hospital, Cambridge Health Alliance, The Baker Center for Children and Families, and Spaulding Rehabilitation Hospital. History Harvard Medical School was founded on September 19, 1782, after President Joseph Willard presented a report with ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Svetlana Mojsov
Svetlana Mojsov is a Macedonian American, ex- Yugoslavian-born chemist who is a research associate professor at Rockefeller University. Her research considers peptide synthesis. She discovered the glucagon-like peptide-1 and uncovered its role in glucose metabolism and the secretion of insulin. Her breakthroughs were transformed by Novo Nordisk into therapeutic agents against diabetes and obesity. Early life and education Mojsov was born in Skopje, Macedonia, ex Yugoslavia and did her undergraduate degree in physical chemistry in Belgrade. She joined the graduate program at the Rockefeller University in 1972, where she worked alongside Robert Bruce Merrifield (1984 Nobel Prize in Chemistry) on the synthesis of peptides. Specifically, Mojsov focused on the synthesis of glucagon, which is released by the pancreas. At the time it was proposed that glucagon might help to treat Type 2 diabetes. Research and career In the 1980s, Mojsov moved to the Massachusetts General Hospital, ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Incretin
Incretins are a group of metabolic hormones that stimulate a decrease in blood glucose levels. Incretins are released after eating and augment the secretion of insulin released from pancreatic beta cells of the islets of Langerhans by a blood-glucose–dependent mechanism. Some incretins (GLP-1) also inhibit glucagon release from the alpha cells of the islets of Langerhans. In addition, they slow the rate of absorption of nutrients into the blood stream by reducing gastric emptying and may directly reduce food intake. The two main candidate molecules that fulfill criteria for an incretin are the intestinal peptides glucagon-like peptide-1 (GLP-1) and gastric inhibitory peptide (GIP, also known as: glucose-dependent insulinotropic polypeptide). Both GLP-1 and GIP are rapidly inactivated by the enzyme dipeptidyl peptidase-4 (DPP-4). Both GLP-1 and GIP are members of the glucagon peptide superfamily. Medical uses Medications based on incretins are used in the treatment of diabe ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Glucagon-like Peptide-1
Glucagon-like peptide-1 (GLP-1) is a 30- or 31-amino-acid-long peptide hormone deriving from the tissue-specific posttranslational processing of the proglucagon peptide. It is produced and secreted by intestinal enteroendocrine L-cells and certain neurons within the nucleus of the solitary tract in the brainstem upon food consumption. The initial product GLP-1 (1–37) is susceptible to amidation and proteolytic cleavage, which gives rise to the two truncated and equipotent biologically active forms, GLP-1 (7–36) amide and GLP-1 (7–37). Active GLP-1 protein secondary structure includes two α-helices from amino acid position 13–20 and 24–35 separated by a linker region. Alongside glucose-dependent insulinotropic peptide (GIP), GLP-1 is an incretin; thus, it has the ability to decrease blood sugar levels in a glucose-dependent manner by enhancing the secretion of insulin. Beside the insulinotropic effects, GLP-1 has been associated with numerous regulatory and protective e ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Glucagon-like Peptide-2
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy Chemotherapy (often abbreviated to chem ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Warren Alpert Foundation Prize
The Warren Alpert Foundation Prize is awarded annually to scientist(s) whose scientific achievements have led to the prevention, cure or treatment of human diseases or disorders, and/or whose research constitutes a seminal scientific finding that holds great promise of ultimately changing our understanding of or ability to treat disease. The prize was established in 1987 by the late philanthropist and businessman Warren Alpert and the Warren Alpert Foundation. The Warren Alpert Prize is given internationally and since its inception, 10 winners have gone on to win Nobel Prizes. The prize is administered in concert with Harvard Medical School in Boston, Massachusetts and the Warren Alpert Foundation, located in Providence, Rhode Island. An annual symposium is held at Harvard Medical School each fall where the recipient(s) present their work. The prize currently includes $500,000, a citation and plaque. Warren Alpert Foundation Prize Recipients See also * List of biomedical science ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Daniel J
Daniel is a masculine given name and a surname of Hebrew origin. It means "God is my judge"Hanks, Hardcastle and Hodges, ''Oxford Dictionary of First Names'', Oxford University Press, 2nd edition, , p. 68. (cf. Gabriel—"God is my strength"), and derives from two early biblical figures, primary among them Daniel from the Book of Daniel. It is a common given name for males, and is also used as a surname. It is also the basis for various derived given names and surnames. Background The name evolved into over 100 different spellings in countries around the world. Nicknames (Dan, Danny) are common in both English and Hebrew; "Dan" may also be a complete given name rather than a nickname. The name "Daniil" (Даниил) is common in Russia. Feminine versions (Danielle, Danièle, Daniela, Daniella, Dani, Danitza) are prevalent as well. It has been particularly well-used in Ireland. The Dutch names "Daan" and "Daniël" are also variations of Daniel. A related surname developed ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
National Academy Of Sciences
The National Academy of Sciences (NAS) is a United States nonprofit, non-governmental organization. NAS is part of the National Academies of Sciences, Engineering, and Medicine, along with the National Academy of Engineering (NAE) and the National Academy of Medicine (NAM). As a national academy, new members of the organization are elected annually by current members, based on their distinguished and continuing achievements in original research. Election to the National Academy is one of the highest honors in the scientific field. Members of the National Academy of Sciences serve '' pro bono'' as "advisers to the nation" on science, engineering, and medicine. The group holds a congressional charter under Title 36 of the United States Code. Founded in 1863 as a result of an Act of Congress that was approved by Abraham Lincoln, the NAS is charged with "providing independent, objective advice to the nation on matters related to science and technology. ... to provide scien ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Canada Gairdner International Award
The Canada Gairdner International Award is given annually by the Gairdner Foundation at a special dinner to five individuals for outstanding discoveries or contributions to medical science. Receipt of the Gairdner is traditionally considered a precursor to winning the Nobel Prize in Medicine; as of 2020, 95 Nobel Prizes have been awarded to prior Gairdner recipients. Canada Gairdner International Awards are given annually in the amount of $100,000 (each) payable in Canadian funds and can be awarded to residents of any country in the world. A joint award may be given for the same discovery or contribution to medical science, but in that case each awardee receives a full prize. Past winners *1959 Alfred Blalock, , Harry M. Rose, William D.M. Paton, Eleanor Zaimis, Wilfred G. Bigelow *1960 Joshua Harold Burn, John H. Gibbon Jr., William F. Hamilton, John McMichael, Karl Meyer, Arnold Rice Rich Arnold Rice Rich (March 28, 1893 – April 17, 1968) was an American path ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
VinFuture Prize
The VinFuture Prize is an annual international award that honors remarkable scientific breakthroughs and promotes innovations for mankind, with involvement from world-renowned scientists, policymakers, business leaders, and Prize holders. It is the first influential and worldwide prize to be founded in Vietnam, and it is hosted by the VinFuture Foundation. The vision of the VinFuture Prize is to catalyze meaningful change in people’s everyday lives through tangible and highly scalable improvements in areas such as productivity, prosperity, connectivity, health, safety, environment, sustainability, as well as their overall happiness regardless of socioeconomic status. History Establishment Since 2017, Vietnam has been working to integrate a more comprehensive STEM education and encourage more individuals to pursue careers in the area. With an influx of STEM students in colleges and internationally trained professionals, Vietnam has enormous potential in science and technology. V ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
VnExpress
''VnExpress'' is a Vietnamese online newspaper, run by FPT Group. It was the first newspaper in Vietnam that was not produced in paper format.Chúc mừng 10 năm thành lập Báo điện tử VnExpress Báo Công an nhân dân. It is one of the most popular websites in according to Alexa Internet
Alexa Internet, Inc. was an American web traffic analysis company based in San Francisco. It was a wholly-owned subsidiary of Amazon.
Alexa was founded as an independent company in 1996 and ac ...
[...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Harvard Medical School Staff
Harvard University is a private Ivy League research university in Cambridge, Massachusetts. Founded in 1636 as Harvard College and named for its first benefactor, the Puritan clergyman John Harvard, it is the oldest institution of higher learning in the United States and one of the most prestigious and highly ranked universities in the world. The university is composed of ten academic faculties plus Harvard Radcliffe Institute. The Faculty of Arts and Sciences offers study in a wide range of undergraduate and graduate academic disciplines, and other faculties offer only graduate degrees, including professional degrees. Harvard has three main campuses: the Cambridge campus centered on Harvard Yard; an adjoining campus immediately across Charles River in the Allston neighborhood of Boston; and the medical campus in Boston's Longwood Medical Area. Harvard's endowment is valued at $50.9 billion, making it the wealthiest academic institution in the world. Endowment inco ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
.JPG "Click for more on -> National Academy Of Sciences")
