|
Anti-aging Cream
Anti-aging creams are predominantly moisturiser-based cosmeceutical skin care products marketed with the promise of making the consumer look younger by reducing, masking or preventing signs of skin aging. These signs are laxity (sagging), rhytids (wrinkles), and photoaging, which includes erythema (redness), dyspigmentation (brown discolorations), solar elastosis (yellowing), keratoses (abnormal growths), and poor texture. Anti-aging supplements are a set of ingestible products that are designed to reduce or diminish the effects of aging. This includes things such as vitamin supplements, powders and teas. They are designed to reduce or diminish the effects of aging. Many products seek to hide the effects of aging while others claim to alter the body's chemical balances to slow the physical effects of aging. A comprehensive grading scale for anti-aging of the skin has been validated and categorizes skin aging as: laxity (sagging), rhytids (wrinkles), and the various categor ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Life Extension
Life extension is the concept of extending the human life expectancy, lifespan, either modestly through improvements in medicine or dramatically by increasing the maximum lifespan beyond its generally-settled oldest people, limit of 125 years. Several researchers in the area, along with "life extensionists", "immortalists" or "longevists" (those who wish to achieve longer lives themselves), postulate that future breakthroughs in tissue rejuvenation (aging), rejuvenation, stem cells, regenerative medicine, molecular repair, gene therapy, pharmaceuticals and organ (anatomy), organ replacement (such as with artificial organs or xenotransplantations) will eventually enable humans to have indefinite lifespans (agerasia) through complete rejuvenation to a healthy youthful condition. The ethical ramifications, if life extension becomes a possibility, are debated by bioethicists. The sale of purported anti-aging products such as supplements and hormone replacement is a lucrative global i ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
World Health Organization
The World Health Organization (WHO) is a specialized agency of the United Nations responsible for international public health. The WHO Constitution states its main objective as "the attainment by all peoples of the highest possible level of health". Headquartered in Geneva, Switzerland, it has six regional offices and 150 field offices worldwide. The WHO was established on 7 April 1948. The first meeting of the World Health Assembly (WHA), the agency's governing body, took place on 24 July of that year. The WHO incorporated the assets, personnel, and duties of the League of Nations' Health Organization and the , including the International Classification of Diseases (ICD). Its work began in earnest in 1951 after a significant infusion of financial and technical resources. The WHO's mandate seeks and includes: working worldwide to promote health, keeping the world safe, and serve the vulnerable. It advocates that a billion more people should have: universal health care coverag ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Peptides
Peptides (, ) are short chains of amino acids linked by peptide bonds. Long chains of amino acids are called proteins. Chains of fewer than twenty amino acids are called oligopeptides, and include dipeptides, tripeptides, and tetrapeptides. A polypeptide is a longer, continuous, unbranched peptide chain. Hence, peptides fall under the broad chemical classes of biological polymers and oligomers, alongside nucleic acids, oligosaccharides, polysaccharides, and others. A polypeptide that contains more than approximately 50 amino acids is known as a protein. Proteins consist of one or more polypeptides arranged in a biologically functional way, often bound to ligands such as coenzymes and cofactors, or to another protein or other macromolecule such as DNA or RNA, or to complex macromolecular assemblies. Amino acids that have been incorporated into peptides are termed residues. A water molecule is released during formation of each amide bond.. All peptides except cyclic peptides ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Epidermis (skin)
The epidermis is the outermost of the three layers that comprise the skin, the inner layers being the dermis and hypodermis. The epidermis layer provides a barrier to infection from environmental pathogens and regulates the amount of water released from the body into the atmosphere through transepidermal water loss. The epidermis is composed of multiple layers of flattened cells that overlie a base layer (stratum basale) composed of columnar cells arranged perpendicularly. The layers of cells develop from stem cells in the basal layer. The human epidermis is a familiar example of epithelium, particularly a stratified squamous epithelium. The word epidermis is derived through Latin , itself and . Something related to or part of the epidermis is termed epidermal. Structure Cellular components The epidermis primarily consists of keratinocytes ( proliferating basal and differentiated suprabasal), which comprise 90% of its cells, but also contains melanocytes, Langerhans c ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Exfoliation (cosmetology)
Exfoliation is the removal of dead skin cells and built-up dirt from the skin's surface. The term comes from the Latin word ''exfoliare'' (to strip off leaves). This is a regular practice within the cosmetic industry, both for its outcome of promoting skin regeneration as well as providing a deep cleanse of the skin barrier. Being used in facials, this process can be achieved by mechanical or chemical means, such as microdermabrasion or chemical peels. Exfoliants are advertised as treatments that enhance beauty and promote a youthful and healthy appearance. History Exfoliation was first practiced among the ancient Egyptians. This was also used in Asia, specifically in China, during the Qing Dynasty (1644–1944). Mechanical Exfoliation Mechanical exfoliation methods involve physically scrubbing the skin with an abrasive material. These types of exfoliants include microfiber cloths, adhesive exfoliation sheets, micro-bead facial scrubs, crêpe paper, crushed apricot kernel or a ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Chemical Peels
A chemical peel is a technique used to improve and smooth the texture of the skin. Facial skin is mostly treated, and scarring can be improved. Chemical peels are intended to remove the outermost layers of the skin. To accomplish this task, the chosen peel solution induces a controlled injury to the skin. Resulting wound healing processes begin to regenerate new tissues. The dead skin eventually peels off. The regenerated skin is usually smoother and less wrinkled than the old skin. Some types of chemical peels can be purchased and administered without a medical license, however people are advised to seek professional help from a dermatologist or plastic surgeon on a specific type of chemical peel before a procedure is performed. Types There are several types of chemical peels. ''α''-hydroxy acid peels Alpha hydroxy acids (AHAs) are naturally occurring carboxylic acids such as glycolic acid, a natural constituent of sugar cane juice, and lactic acid, found in sour milk and tomato ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Beta Hydroxy Acid
A beta hydroxy acid or β-hydroxy acid (BHA) is an organic compound that contains a carboxylic acid functional group and hydroxy functional group separated by ''two'' carbon atoms. They are closely related to alpha hydroxy acids, in which the two functional groups are separated by ''one'' carbon atom. In cosmetics, the term ''beta hydroxy acid'' refers specifically to salicylic acid, which is used in some "anti-aging" creams and acne treatments. It is used to combat inflammation. Upon dehydration, beta-hydroxy acids yield an alpha-beta unsaturated acid. Acidic properties Compared to non-hydroxylated carboxylic acids, this group of acids is stronger, although less strong than the alpha hydroxy acids. Due to the larger distance, the intramolecular hydrogen bridge is less easily formed compared to the alpha hydroxy acids. The table summarizes some values on the propionic series. {, class="wikitable" ! Name ! p''K''a , - , Propanoic acid , , 4.87Handbook of Chemistry an ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Alpha Hydroxy Acid
α-Hydroxy acids, or alpha hydroxy acids (AHAs), are a class of chemical compounds that consist of a carboxylic acid with a hydroxyl group substituent on the adjacent (alpha) carbon. Prominent examples are glycolic acid, lactic acid, mandelic acid and citric acid. Although these compounds are related to the ordinary carboxylic acids and are therefore weak acids, their chemical structure allows for the formation of an internal hydrogen bond between the hydrogen at the hydroxyl group and one of the oxygen atoms of the carboxylic group. The net effect is an increase in acidity. For example, the pKa of lactic acid is 3.86, while that of the unsubstituted propionic acid is 4.87; a full pKa unit difference means that lactic acid is ten times stronger than propionic acid. Industrial applications Feed additives 2-Hydroxy-4-(methylthio)butyric acid is produced commercially as a racemic mixture to substitute for methionine in animal feed. In nature, the same compound is an intermediat ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Equol
Equol (4',7-isoflavandiol) is an isoflavandiolThe structures of 7,4’-dihydroxy-isoflavan and its precursors is shown iStructural Elucidation of Hydroxylated Metabolites of the Isoflavan Equol by GC/MS and HPLC/MSby Corinna E. Rüfer, Hansruedi Glatt, and Sabine E. Kulling in ''Drug Metabolism and Disposition'' (2005, electronic publication). estrogen metabolized from daidzein, a type of isoflavone found in soybeans and other plant sources, by bacterial flora in the intestines. While endogenous estrogenic hormones such as estradiol are steroids, equol is a nonsteroidal estrogen. Only about 30–50% of people have intestinal bacteria that make equol. History (''S'')-Equol was first isolated from horse urine in 1932, and the name was suggested by this equine connection. Since then, equol has been found in the urine or plasma of many other animal species, although these animals have significant differences in their ability to metabolize daidzein into equol. In 1980, scientists repo ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Skin Pharmacology And Applied Skin Physiology
''Skin Pharmacology and Physiology'' is a peer-reviewed medical journal and an official journal of the Society for Dermopharmacy / Gesellschaft für Dermopharmazie e.V. (GD). It was established in 1988 under the title ''Skin Pharmacology'', renamed to ''Skin Pharmacology and Applied Skin Physiology'' in 1998, and obtained its current title in 2003. According to the ''Journal Citation Reports'', the journal has a 2014 impact factor The impact factor (IF) or journal impact factor (JIF) of an academic journal is a scientometric index calculated by Clarivate that reflects the yearly mean number of citations of articles published in the last two years in a given journal, as i ... of 2.366. References External links * English-language journals Pharmacology journals Dermatology journals Karger academic journals Academic journals established in 1988 Bimonthly journals {{med-journal-stub ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Collagen
Collagen () is the main structural protein in the extracellular matrix found in the body's various connective tissues. As the main component of connective tissue, it is the most abundant protein in mammals, making up from 25% to 35% of the whole-body protein content. Collagen consists of amino acids bound together to form a triple helix of elongated fibril known as a collagen helix. It is mostly found in connective tissue such as cartilage, bones, tendons, ligaments, and skin. Depending upon the degree of mineralization, collagen tissues may be rigid (bone) or compliant (tendon) or have a gradient from rigid to compliant (cartilage). Collagen is also abundant in corneas, blood vessels, the gut, intervertebral discs, and the dentin in teeth. In muscle tissue, it serves as a major component of the endomysium. Collagen constitutes one to two percent of muscle tissue and accounts for 6% of the weight of the skeletal muscle tissue. The fibroblast is the most common cell that crea ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Epidermal Growth Factor
Epidermal growth factor (EGF) is a protein that stimulates cell growth and differentiation by binding to its receptor, EGFR. Human EGF is 6-k Da and has 53 amino acid residues and three intramolecular disulfide bonds. EGF was originally described as a secreted peptide found in the submaxillary glands of mice and in human urine. EGF has since been found in many human tissues, including platelets, submandibular gland (submaxillary gland), and parotid gland. Initially, human EGF was known as urogastrone. Structure In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42). Function EGF, via binding to its cognate receptor, results in cellular proliferation, differentiation, and survival. Salivary EGF, which seems to be regulated by dietary inorganic iodine, also plays an important physiological role in the maintenance of ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
.svg "Click for more on -> Collagen")
