Daniel J. Drucker
   HOME

TheInfoList



OR:

Daniel Joshua Drucker (born 23 June 1956) is a Canadian endocrinologist. A
Fellow of the Royal Society Fellowship of the Royal Society (FRS, ForMemRS and HonFRS) is an award granted by the judges of the Royal Society of London to individuals who have made a "substantial contribution to the improvement of natural knowledge, including mathemat ...
, he is a professor of medicine at the Lunenfeld-Tanenbaum Research Institute,
Mount Sinai Hospital, Toronto Mount Sinai Hospital (MSH) is a hospital in Toronto, Ontario, Canada. Mount Sinai is part of Sinai Health. Sinai Health was formed through the voluntary amalgamation of Mount Sinai Hospital (including the Lunenfeld-Tanenbaum Research Institute) ...
. He is known for his research into intestinal hormones and their use in the treatment of diabetes and other metabolic diseases.


Early life and education

Drucker was born and grew up in Montreal, and then enrolled in the
University of Ottawa The University of Ottawa (french: Université d'Ottawa), often referred to as uOttawa or U of O, is a bilingual public research university in Ottawa, Ontario, Canada. The main campus is located on directly to the northeast of Downtown Ottaw ...
."This Toronto doctor is a superstar in the world of diabetes research — and he says it all started as a fluke"
''Toronto Star'', By Joseph Hall, 7 February 2020
After graduation he moved to Toronto, where he studied medicine at the
University of Toronto The University of Toronto (UToronto or U of T) is a public university, public research university in Toronto, Ontario, Canada, located on the grounds that surround Queen's Park (Toronto), Queen's Park. It was founded by royal charter in 1827 ...
, graduating in 1980. He received postgraduate training (medicine and endocrinology) at
Johns Hopkins Hospital The Johns Hopkins Hospital (JHH) is the teaching hospital and biomedical research facility of the Johns Hopkins School of Medicine, located in Baltimore, Maryland, U.S. It was founded in 1889 using money from a bequest of over $7 million (1873 m ...
(1980–81), and the University of Toronto (1980–84).


Career

Beginning in 1984, Drucker worked as a research fellow at the Massachusetts General Hospital and
Harvard Medical School Harvard Medical School (HMS) is the graduate medical school of Harvard University and is located in the Longwood Medical Area of Boston, Massachusetts. Founded in 1782, HMS is one of the oldest medical schools in the United States and is consi ...
, studying molecular endocrinology. In 1987 he returned to Toronto, taking on the position of assistant professor of medicine at the University of Toronto and working as a staff doctor. Early in his career Drucker studied the effect of hormones in the gut on the onset and development of
Type 2 diabetes Type 2 diabetes, formerly known as adult-onset diabetes, is a form of diabetes mellitus that is characterized by high blood sugar, insulin resistance, and relative lack of insulin. Common symptoms include increased thirst, frequent urinatio ...
. In 1996, he identified the effects that
GLP-2 Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process ...
has on small bowel proliferation in rats. His research led to the development of two types of drugs for the treatment of the disease. Drucker joined the staff of the Samuel Lunenfeld Research Institute at Mount Sinai Hospital in 2006. In 2008 he conducted studies aimed at the development and testing of long-acting insulin-control medication. He later studied the long-term effects of related weight-loss medicines on bowel health. A Canada Research Chair at the University of Toronto, Drucker also developed treatments for short bowel syndrome, a disorder in which fluids are poorly absorbed after resection of the small intestine.


Awards and honours

Drucker has received many national and international awards in recognition of his research accomplishments revealing the mechanisms of action and therapeutic potential of enteroendocrine hormones. These include the Prix Galien Canada for outstanding academic research (2008), the Donald F. Steiner Award for Outstanding Diabetes Research from the
University of Chicago The University of Chicago (UChicago, Chicago, U of C, or UChi) is a private university, private research university in Chicago, Illinois. Its main campus is located in Chicago's Hyde Park, Chicago, Hyde Park neighborhood. The University of Chic ...
(2007), the Clinical Investigator Award from the Endocrine Society (2009), the
Claude Bernard Claude Bernard (; 12 July 1813 – 10 February 1878) was a French physiologist. Historian I. Bernard Cohen of Harvard University called Bernard "one of the greatest of all men of science". He originated the term '' milieu intérieur'', and the ...
Prize from the European Association for the Study of Diabetes (2012), the Oon International Award and Lecture from the
University of Cambridge The University of Cambridge is a public collegiate research university in Cambridge, England. Founded in 1209 and granted a royal charter by Henry III in 1231, Cambridge is the world's third oldest surviving university and one of its most pr ...
(2014), the Banting Medal for Scientific Achievement from the American Diabetes Association (2014) the Manpei Suzuki Foundation International Prize for Diabetes (2014), and the Harold Hamm International Prize for Biomedical Research in Diabetes (2019). In 2021 he was awarded the
Canada Gairdner International Award The Canada Gairdner International Award is given annually by the Gairdner Foundation at a special dinner to five individuals for outstanding discoveries or contributions to medical science. Receipt of the Gairdner is traditionally considered a p ...
. and in 2023 the Wolf Prize in Medicine. Drucker was named an
Officer of the Order of Canada The Order of Canada (french: Ordre du Canada; abbreviated as OC) is a Canadian state order and the second-highest Award, honour for merit in the system of orders, decorations, and medals of Canada, after the Order of Merit. To coincide with ...
in 2015."Four Nova Scotians among Order of Canada honourees"
''
The Chronicle-Herald ''The Chronicle Herald'' is a broadsheet newspaper published in Halifax, Nova Scotia, Canada owned by SaltWire Network of Halifax. The paper's newsroom staff were locked out of work from January 2016 until August 2017. ''Herald'' management cont ...
'', 1 July 2015.
He was elected a Fellow of the Royal Society (FRS) in 2015.


Selected publications

* * * * *


References


External links

* * {{DEFAULTSORT:Drucker, Daniel J. 1956 births Living people Canadian Fellows of the Royal Society University of Toronto alumni Academic staff of the University of Toronto Officers of the Order of Canada Academics from Montreal University of Ottawa alumni Foreign associates of the National Academy of Sciences