Acetylserotonin O-methyltransferase
   HOME

TheInfoList



OR:

N-Acetylserotonin O-methyltransferase, also known as ASMT, is an enzyme which catalyzes the final reaction in
melatonin Melatonin is a natural product found in plants and animals. It is primarily known in animals as a hormone released by the pineal gland in the brain at night, and has long been associated with control of the sleep–wake cycle. In vertebrates ...
biosynthesis: converting Normelatonin to melatonin. This reaction is embedded in the more general tryptophan metabolism pathway. The enzyme also catalyzes a second reaction in tryptophan metabolism: the conversion of
5-hydroxy-indoleacetate 5-Hydroxyindoleacetic acid (5-HIAA) is the main metabolite of serotonin. In chemical analysis of urine samples, 5-HIAA is used to determine serotonin levels in the body. Clinical significance 5-HIAA is tested by 24-hour urine samples combin ...
to 5-methoxy-indoleacetate. The other enzyme which catalyzes this reaction is n-acetylserotonin-o-methyltransferase-like-protein. In humans the ASMT enzyme is encoded by the
pseudoautosomal The pseudoautosomal regions, PAR1, PAR2, are homologous sequences of nucleotides on the X and Y chromosomes. The pseudoautosomal regions get their name because any genes within them (so far at least 29 have been found for humans) are inherited ...
''ASMT'' gene. A copy exists near the endcaps of the short arms of both the X chromosome and the Y chromosome.


Structure and gene location

''N-Acetylserotonin O-methyltransferase'' is an enzyme that is coded for by genes located on the pseudoautosomal region of the X and Y chromosome, and is most abundantly found in the
pineal gland The pineal gland, conarium, or epiphysis cerebri, is a small endocrine gland in the brain of most vertebrates. The pineal gland produces melatonin, a serotonin-derived hormone which modulates sleep, sleep patterns in both circadian rhythm, circ ...
and retina of humans. The structure of ''N- Acetylserotonin O-methyltransferase'' has been determined by
X-ray diffraction X-ray crystallography is the experimental science determining the atomic and molecular structure of a crystal, in which the crystalline structure causes a beam of incident X-rays to diffract into many specific directions. By measuring the angles ...
.


Class of enzyme and function

''N-Acetylserotonin O-methyltransferase'' can be classified under three types of enzyme functional groups: transferases, one-carbon group transferrers, and methyltransferases. It catalyzes two reactions in the tryptophan metabolism pathway, and both can be traced back to
serotonin Serotonin () or 5-hydroxytryptamine (5-HT) is a monoamine neurotransmitter. Its biological function is complex and multifaceted, modulating mood, cognition, reward, learning, memory, and numerous physiological processes such as vomiting and vas ...
. Serotonin has many fates in this pathway, and ''N- Acetylserotonin O-methyltransferase'' catalyzes reactions in two of these fates. The enzyme has been studied most for its catalysis of the final step of the pathway from serotonin to melatonin, but it also catalyzes one of the reactions in the many step process of serotonin → 5-Methoxy-indolacetate.


Synonyms

Synonyms of ''N- Acetylserotonin O-methyltransferase'' are ''Hydroxyindole O-methyltransferase'' (HIOMT), ''Acetylserotonin O-methyltransferase'' (ASMT), ''Acetylserotonin N-methyltransferase'', ''Acetylserotonin methyltransferase'' (Y chromosome). The most commonly used synonym is ''Hydroxyindole O-methyltransferase'' (HIOMT).


Organisms

''N- Acetylserotonin O-methyltransferase'' is found in both prokaryotes and
eukaryote Eukaryotes () are organisms whose cells have a nucleus. All animals, plants, fungi, and many unicellular organisms, are Eukaryotes. They belong to the group of organisms Eukaryota or Eukarya, which is one of the three domains of life. Bacte ...
s. It is found in the bacteria ''Rhodopirellula baltica'' and '' Chromobacterium violaceum''. It is also found in the following eukaryotes: '' Gallus gallus'' (chicken), ''
Bos taurus Cattle (''Bos taurus'') are large, domesticated, cloven-hooved, herbivores. They are a prominent modern member of the subfamily Bovinae and the most widespread species of the genus ''Bos''. Adult females are referred to as cows and adult ma ...
'' (cow), '' Homo sapiens'' (human), '' Macaca mulatta'' (rhesus monkey), and '' Rattus norvegicus'' (rat).


Amino acid sequences

''Bos taurus'' (cattle) has 350
amino acids Amino acids are organic compounds that contain both amino and carboxylic acid functional groups. Although hundreds of amino acids exist in nature, by far the most important are the alpha-amino acids, which comprise proteins. Only 22 alpha am ...
and the amino acid sequence is: MCSQEGEGYSLLKEYANAFMVSQVLFAACELGVFELLAEALEPLDSAAVSSHLGSSPGD RAATEHLCVPEAAASRREGRKSCVCKHGARQHLPGERQPQVPAGHAAVRGQDRLRLLAP PGEAVREGRNQYLKAFGIPSEELFSAIYRSEDERLQFMQGLQDVWRLEGATVLAAFDLS PFPLICDLGGGSGALAKACVSLYPGCRAIVFDIPGVVQIAKRHFSASEDERISFHEGDF FKDALPEADLYILARVLHDWTDAKCSHLLQRVYRACRTGGGILVIESLLDTDGRGPLTT LLYSLNMLVQTEGRERTPGRSTARSVGPAASETCGDGGRGEPTMLSWPGNQACSV For ''Homo sapiens'' (human) with 373 amino acids the sequence is: MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHG TELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWG HLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDL SVFPLMCDLGGTRIKLETIILSKLSQGQKTKHRVFSLIGGAGALAKECMSLYPGCKITV FDIPEVVWTAKQHFSFQEEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLE RIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGF RDFQFKKTGAIYDAILARK


Alternative splicing

The human HOIMT gene is approximately 35 kb in length and contains 9-10
exon An exon is any part of a gene that will form a part of the final mature RNA produced by that gene after introns have been removed by RNA splicing. The term ''exon'' refers to both the DNA sequence within a gene and to the corresponding sequen ...
s. The gene can be alternatively spliced to form at least three possible isoforms, although each of these isoforms has the same role in the biosynthesis of melatonin. It has also been found that the gene contains multiple promoter regions, an indication that multiple mechanisms of regulation exist.


Expression in immune cells

Recent studies found
messenger RNA In molecular biology, messenger ribonucleic acid (mRNA) is a single-stranded molecule of RNA that corresponds to the genetic sequence of a gene, and is read by a ribosome in the process of synthesizing a protein. mRNA is created during the p ...
(mRNA) transcripts of the HOIMT gene in B lymphocytes, T helper lymphocytes, cytoxic T lymphocytes, and natural killer lymphocytes in humans. This finding, in conjunction with research on alternative splicing of the HOIMT
hnRNA A primary transcript is the single-stranded ribonucleic acid (RNA) product synthesized by transcription of DNA, and processed to yield various mature RNA products such as mRNAs, tRNAs, and rRNAs. The primary transcripts designated to be mRNAs a ...
, suggests that ''Hydroxyindole O-methyltransferase'' (synonym for ''N- Acetylserotonin O-methyltransferase'') plays a role in the human immune system, in addition to its endocrine and nervous system functions. In other words, the gene may be expressed in various isoforms in different cells of the body.


Reactions catalyzed

In the tryptophan metabolism pathway, ''N- Acetylserotonin O-methyltransferase'' catalyzes two separate reactions. The first reaction shown (Figure 2) is the reaction of N-acetyl-serotonin to N-acetyl-5-methoxy-tryptamine. S-adenosyl-L-methionine is used as a substrate and is converted to S-adenosyl-L-homocysteine. Figure 2: Reaction catalyzed by ''N- Acetylserotonin O-methyltransferase'' Figure 3 is the same reaction as above, but the figure provides a clearer picture of how the reactant proceeds to product using ''N-Acetylserotonin O-methyltransferase'' in addition to the substrate. Figure 3: Role of ''N- Acetylserotonin O-methyltransferase'' The second reaction (Figure 4) catalyzed by ''N-Acetylserotonin O-methyltransferase'' in the tryptophan metabolism pathway is: S-Adenosyl-L-methionine + 5-Hydroxyindoleacetate ↔ S-Adenosyl-L-homocysteine + 5-Methoxyindoleacetate. Figure 4: Second reaction catalyzed by ''N- Acetylserotonin O-methyltransferase'' Figure 5 is a more general scheme of the reaction pathway from serotonin to melatonin. The number 2.1.1.4 refers to the Enzyme Commission Number (EC Number) for ''N- Acetylserotonin O-methyltransferase''. These two steps are embedded in the highly involved tryptophan metabolism pathway. Figure 5: Pathway serotonin → melatonin


Clinical implications


Tumors

There is evidence of high HIOMT gene expression in pineal parenchymal tumors (PPTs). This finding has led to the study of varying gene expression as a diagnostic marker for such tumors. Abnormally high levels of HIOMT in these glands could serve as an indication of the existence of PPTs in the brain.


Psychiatric disorders

Melatonin levels are used as a trait marker for mood disorders, meaning that abnormal levels of melatonin can be used in conjunction with other diagnostic criteria to determine whether a mood disorder (e.g. Seasonal affective disorder, bipolar disorder, or major depressive disorder) exists. Melatonin levels can also be used as a state marker, contributing to conclusions on the severity of a patient's illness at a given point in time. Because studies have shown a direct correlation between the amount of ''hydroxyindole-O-methyltransferase'' in the pineal gland and the melatonin level, additional knowledge of HIOMT could provide valuable insight on the nature and onset of these impairing disorders.


Developmental disorders

Subjects with
autism The autism spectrum, often referred to as just autism or in the context of a professional diagnosis autism spectrum disorder (ASD) or autism spectrum condition (ASC), is a neurodevelopmental condition (or conditions) characterized by difficulti ...
were found to have significantly lower levels of
melatonin Melatonin is a natural product found in plants and animals. It is primarily known in animals as a hormone released by the pineal gland in the brain at night, and has long been associated with control of the sleep–wake cycle. In vertebrates ...
and acetylserotonin O-methyltransferase (ASMT) than controls.


Linkage analysis

High frequency polymorphism exists on the PAR region of the sex chromosomes, where the HIOMT gene is located. Linkage analysis of a diseased locus with high frequency polymorphism of this region could lead to vital information about the role of this gene in genetic disorders.


Additional research

HIOMT as the limiting reagent in the melatonin biosynthetic pathway There has been some controversy over the regulatory power of ''hydroxyindole-O-methyltransferase'' in the production of melatonin. In 2001, it was argued that another enzyme in the pathway, ''N-acetyl transferase'' (NAT) was the limiting reagent in the production of melatonin. Recent findings, however, have suggested that HIOMT, not NAT, is the limiting reagent, and a direct correlation between HIOMT expression and melatonin levels has been shown to exist.


See also

* Methyltransferase


References


Further reading

* * * * * * * * * * * * * * *


External links

* * * {{One carbon transferases Transferases Biology of bipolar disorder