HOME
*



picture info

Vanderbilt Transplant Center
The Vanderbilt University Medical Center (VUMC) is a medical provider with multiple hospitals in Nashville, Tennessee, as well as clinics and facilities throughout Middle Tennessee. VUMC is an independent non-profit organization, but maintains academic affiliations with Vanderbilt University. As of 2022, the health system had more than 3 million patient visits a year, a workforce of 40,000, and 1,709 licensed hospital beds. Overview VUMC comprises the following units: * Vanderbilt University Adult Hospital * Monroe Carell Jr. Children's Hospital at Vanderbilt * Vanderbilt-Ingram Cancer Center * The Vanderbilt Clinic * Vanderbilt Bill Wilkerson Center * Vanderbilt Stallworth Rehabilitation Hospital * Vanderbilt Psychiatric Hospital * Eskind Biomedical Library * Vanderbilt Sports Medicine * Dayani Human Performance Center * Vanderbilt Heart & Vascular Institute *Nashville Biosciences (''aka'' NashBio), a subsidiary spun out from the university in 2018 VUMC also has hospitals, cli ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Nashville, Tennessee
Nashville is the capital city of the U.S. state of Tennessee and the seat of Davidson County. With a population of 689,447 at the 2020 U.S. census, Nashville is the most populous city in the state, 21st most-populous city in the U.S., and the fourth most populous city in the southeastern U.S. Located on the Cumberland River, the city is the center of the Nashville metropolitan area, which is one of the fastest growing in the nation. Named for Francis Nash, a general of the Continental Army during the American Revolutionary War, the city was founded in 1779. The city grew quickly due to its strategic location as a port on the Cumberland River and, in the 19th century, a railroad center. Nashville seceded with Tennessee during the American Civil War; in 1862 it was the first state capital in the Confederacy to be taken by Union forces. After the war, the city reclaimed its position and developed a manufacturing base. Since 1963, Nashville has had a consolidated city-co ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Flight Nurse
A flight nurse is a registered nurse who specialises in the field of providing comprehensive pre-hospital, emergency critical care, and hospital care to a vast scope of patients. The care of these patients is generally during aeromedical evacuation or rescue operations aboard helicopters, propeller aircraft or jet aircraft. On board a rescue aircraft you would find a flight nurse accompanied by flight medics and respiratory practitioners, as well as the option of a flight physician for comprehensive emergency and critical transport teams. The inclusion of a flight physician is more commonly seen in pediatric and neonatal transport teams. A critical care flight nurse must be able to deal with all age groups with broad critical emergencies. With no physicians on site the nurses scope of practice is expanded. The critical care experience is transferred over to a flight nurse with impacting factors such as altitude and changes in pressure, gravitational forces, and weather (Mazur, ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  




Alfred Blalock
Alfred Blalock (April 5, 1899 – September 15, 1964) was an American surgeon most noted for his work on the medical condition of shock as well as Tetralogy of Fallot— commonly known as Blue baby syndrome. He created, with assistance from his research and laboratory assistant Vivien Thomas and pediatric cardiologist Helen Taussig, the Blalock-Thomas-Taussig Shunt, a surgical procedure to relieve the cyanosis from Tetralogy of Fallot. This operation ushered in the modern era of cardiac surgery. He worked at both Vanderbilt University and Johns Hopkins University, where he studied medicine and later served as chief of surgery. He is known as a medical pioneer who won various awards, including Albert Lasker Clinical Medical Research Award. Blalock was also nominated several times for the prestigious Nobel Prize in Medicine. Early life and education Blalock was born in Culloden, Georgia, the son of Martha "Mattie" (Davis) and George Zadock Blalock, a merchant. At the age of ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Hormone
A hormone (from the Greek participle , "setting in motion") is a class of signaling molecules in multicellular organisms that are sent to distant organs by complex biological processes to regulate physiology and behavior. Hormones are required for the correct development of animals, plants and fungi. Due to the broad definition of a hormone (as a signaling molecule that exerts its effects far from its site of production), numerous kinds of molecules can be classified as hormones. Among the substances that can be considered hormones, are eicosanoids (e.g. prostaglandins and thromboxanes), steroids (e.g. oestrogen and brassinosteroid), amino acid derivatives (e.g. epinephrine and auxin), protein or peptides (e.g. insulin and CLE peptides), and gases (e.g. ethylene and nitric oxide). Hormones are used to communicate between organs and tissues. In vertebrates, hormones are responsible for regulating a variety of physiological processes and behavioral activities such ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Epidermal Growth Factor
Epidermal growth factor (EGF) is a protein that stimulates cell growth and differentiation by binding to its receptor, EGFR. Human EGF is 6-k Da and has 53 amino acid residues and three intramolecular disulfide bonds. EGF was originally described as a secreted peptide found in the submaxillary glands of mice and in human urine. EGF has since been found in many human tissues, including platelets, submandibular gland (submaxillary gland), and parotid gland. Initially, human EGF was known as urogastrone. Structure In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42). Function EGF, via binding to its cognate receptor, results in cellular proliferation, differentiation, and survival. Salivary EGF, which seems to be regulated by dietary inorganic iodine, also plays an important physiological role in the mai ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Rita Levi-Montalcini
Rita Levi-Montalcini (, ; 22 April 1909 – 30 December 2012) was an Italian Nobel laureate, honored for her work in neurobiology. She was awarded the 1986 Nobel Prize in Physiology or Medicine jointly with colleague Stanley Cohen for the discovery of nerve growth factor (NGF). From 2001 until her death, she also served in the Italian Senate as a Senator for Life. This honor was given due to her significant scientific contributions. On 22 April 2009, she became the first Nobel laureate to reach the age of 100, and the event was feted with a party at Rome's City Hall. Early life and education Levi-Montalcini was born on 22 April 1909 in Turin, to Italian Jewish parents with roots dating back to the Roman Empire. She and her twin sister Paola were the youngest of four children. Her parents were Adele Montalcini, a painter, and Adamo Levi, an electrical engineer and mathematician, whose families had moved from Asti and Casale Monferrato, respectively, to Turin at the turn o ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


Stanley Cohen (biochemist)
Stanley Cohen (November 17, 1922 – February 5, 2020) was an American biochemist who, along with Rita Levi-Montalcini, was awarded the Nobel Prize in Physiology or Medicine in 1986 for the isolation of nerve growth factor and the discovery of epidermal growth factor. He died in February 2020 at the age of 97. Early life and education Cohen was born in Brooklyn, New York, on November 17, 1922. He was the son of Fannie (née Feitel) and Louis Cohen, a tailor. His parents were Jewish immigrants. Cohen received his bachelor's degree in 1943 from Brooklyn College, where he had double-majored in chemistry and biology. After working as a bacteriologist at a milk processing plant to earn money, he received his Master of Arts in zoology from Oberlin College in 1945. He earned a doctorate from the department of biochemistry about the metabolism of earthworms at the University of Michigan in 1948. Career His first academic employment was at the University of Colorado studying the metabo ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


Cyclic AMP
Cyclic adenosine monophosphate (cAMP, cyclic AMP, or 3',5'-cyclic adenosine monophosphate) is a second messenger important in many biological processes. cAMP is a derivative of adenosine triphosphate (ATP) and used for intracellular signal transduction in many different organisms, conveying the cAMP-dependent pathway. History Earl Sutherland of Vanderbilt University won a Nobel Prize in Physiology or Medicine in 1971 "for his discoveries concerning the mechanisms of the action of hormones", especially epinephrine, via second messengers (such as cyclic adenosine monophosphate, cyclic AMP). Synthesis Cyclic AMP is synthesized from ATP by adenylate cyclase located on the inner side of the plasma membrane and anchored at various locations in the interior of the cell. Adenylate cyclase is ''activated'' by a range of signaling molecules through the activation of adenylate cyclase stimulatory G ( Gs)-protein-coupled receptors. Adenylate cyclase is ''inhibited'' by agonists of a ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


Earl Sutherland, Jr
Earl Wilbur Sutherland Jr. (November 19, 1915 – March 9, 1974) was an American pharmacologist and biochemist born in Burlingame, Kansas. Sutherland won a Nobel Prize in Physiology or Medicine in 1971 "for his discoveries concerning the mechanisms of the action of hormones", especially epinephrine, via second messengers, namely cyclic adenosine monophosphate, or cyclic AMP. Early life Sutherland was born on November 19, 1915, in Burlingame, Kansas. The second youngest of six children, he was raised by his mother, Edith M. Hartshorn, and his father, Earl W. Sutherland.Gale Group (2006)“World of Scientific Discovery on Earl Sutherland” World of Scientific Discovery. Though his father, who was originally from Wisconsin, had attended Grinnell College for two years, he ultimately led an agrarian lifestyle that took him to both New Mexico and Oklahoma before settling down in Burlingame to raise a family. Edith, a Missouri native, had some training in nursing at what was called a ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Nobel Prize In Physiology Or Medicine
The Nobel Prize in Physiology or Medicine is awarded yearly by the Nobel Assembly at the Karolinska Institute for outstanding discoveries in physiology or medicine. The Nobel Prize is not a single prize, but five separate prizes that, according to Alfred Nobel's 1895 will, are awarded "to those who, during the preceding year, have conferred the greatest benefit to humankind". Nobel Prizes are awarded in the fields of Physics, Chemistry, Physiology or Medicine, Literature, and Peace. The Nobel Prize is presented annually on the anniversary of Alfred Nobel's death, 10 December. As of 2022, 114 Nobel Prizes in Physiology or Medicine have been awarded to 226 laureates, 214 men and 12 women. The first one was awarded in 1901 to the German physiologist, Emil von Behring, for his work on serum therapy and the development of a vaccine against diphtheria Diphtheria is an infection caused by the bacterium '' Corynebacterium diphtheriae''. Most infections are asymptomatic or ha ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

National Institutes Of Health
The National Institutes of Health, commonly referred to as NIH (with each letter pronounced individually), is the primary agency of the United States government responsible for biomedical and public health research. It was founded in the late 1880s and is now part of the United States Department of Health and Human Services. The majority of NIH facilities are located in Bethesda, Maryland, and other nearby suburbs of the Washington metropolitan area, with other primary facilities in the Research Triangle Park in North Carolina and smaller satellite facilities located around the United States. The NIH conducts its own scientific research through the NIH Intramural Research Program (IRP) and provides major biomedical research funding to non-NIH research facilities through its Extramural Research Program. , the IRP had 1,200 principal investigators and more than 4,000 postdoctoral fellows in basic, translational, and clinical research, being the largest biomedical research ins ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  




Central Parking Corporation
SP Plus Corporation is an American provider of parking facility management services. It manages parking facilities with more than one million parking spaces across the United States and Canada. Until December 2013, it was known as Standard Parking Corporation. The company employs more than 26,000 people to manage 4,200 parking facility locations, as well as parking and shuttle bus operations at 75 airports. Company history Standard Parking began in 1929 in Chicago, Illinois, where it was operated by David and Benjamin Warshauer as a family owned and controlled business. The business operated under the corporate name of Standard Parking Corporation from 1981 until 1995, at which time it was reconstituted as a limited partnership named Standard Parking, L.P. March 1998, Standard Parking merged with APCOA, Inc., forming APCOA/Standard Parking, Inc. In April 2003, APCOA/Standard Parking, Inc. changed its corporate name to Standard Parking Corporation. In June 2004, Standard Parking ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]