|
SNX-482
SNX-482 is a toxin from the tarantula ''Hysterocrates gigas''. It acts as a high-affinity blocker of R-type Ca2+ (Cav2.3) channels, but at higher concentrations it can also block other Ca2+ channels and Na+ channels. Sources SNX-482 is isolated from the venom of the spider ''Hysterocrates gigas''.Robert Newcomb, et al., ''Biochemistry'' 1998, 37, 15353–15362 Sequence GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD-OH Homology SNX-482 is homologous to the spider peptides grammatoxin S1A and hanatoxin. Target Cav2.3 (alpha1E, R-type) channel (strong affinity), L-type Ca2+ channel, P/Q type Ca2+ channel, Na+ channel.Emmanuel Bourinet, et al., ''Biophysical Journal'', Volume 81, July 2001 79–88G Arroyo, et al., ''Eur J Pharmacol'', 2003, 475: 11–8 Mode of action The compound was initially identified as a selective, voltage-dependent inhibitor of Cav2.3 (a1E, R-type) channels. SNX-482 inhibits native R-type Ca2+ currents at weak nanomolar concentrations in rat neurohy ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Hysterocrates Gigas
''Hysterocrates gigas'' is a member of the tarantula family, Theraphosidae found in Cameroon. It is known as the giant baboon spider, Cameroon red baboon spider, or red baboon tarantula. Description This is a burrowing spider and ranges in color from a dull black and gray to a rusty orange/brown. It is black when freshly moulted (post-moult) and turns brown just before a moult (pre-moult). Its eyes are small and weak and only able to judge light levels. Its abdomen is oval in shape with a diameter up to . Although it has hairy legs, this tarantula is an Old World species and does not have urticating hairs on its abdomen. (Urticating hairs are hairs found in most new world species (those from North and South America) that can be shed in defence, they are barbed and may cause severe itching.) It also has a leg span which may reach . This tarantula, in common with the rest of the family, has downward-facing, parallel fangs, used like pickaxes rather than pincers. Adult males ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Receptor Antagonist
A receptor antagonist is a type of receptor ligand or drug that blocks or dampens a biological response by binding to and blocking a receptor rather than activating it like an agonist. Antagonist drugs interfere in the natural operation of receptor proteins.Pharmacology Guide: In vitro pharmacology: concentration-response curves " '' GlaxoWellcome.'' Retrieved on December 6, 2007. They are sometimes called blockers; examples include alpha blockers, |
R-type Calcium Channel
The R-type calcium channel is a type of voltage-dependent calcium channel. Like the others of this class, the α1 subunit forms the pore through which calcium enters the cell and determines most of the channel's properties. This α1 subunit is also known as the calcium channel, voltage-dependent, R type, alpha 1E subunit (CACNA1E) or Cav2.3 which in humans is encoded by the ''CACNA1E'' gene. They are strongly expressed in cortex, hippocampus, striatum, amygdala and interpeduncular nucleus. They are poorly understood, but like Q-type calcium channels, they appear to be present in cerebellum, cerebellar granule cells. They have a high threshold of activation and relatively slow kinetics. References Further reading * * * * * * * * * * * * * * * * * * * External links * * {{Ion channels, g1 Ion channels Electrophysiology Integral membrane proteins Calcium channels ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Venom
Venom or zootoxin is a type of toxin produced by an animal that is actively delivered through a wound by means of a bite, sting, or similar action. The toxin is delivered through a specially evolved ''venom apparatus'', such as fangs or a stinger, in a process called envenomation. Venom is often distinguished from poison, which is a toxin that is passively delivered by being ingested, inhaled, or absorbed through the skin, and toxungen, which is actively transferred to the external surface of another animal via a physical delivery mechanism. Venom has evolved in terrestrial and marine environments and in a wide variety of animals: both predators and prey, and both vertebrates and invertebrates. Venoms kill through the action of at least four major classes of toxin, namely necrotoxins and cytotoxins, which kill cells; neurotoxins, which affect nervous systems; myotoxins, which damage muscles; and haemotoxins, which disrupt blood clotting. Venomous animals cause tens of thousa ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Grammotoxin
Grammotoxin is a toxin in the venom of the tarantula '' Grammostola spatulata''. It is a protein toxin that inhibits P-, Q- and N-type voltage-gated calcium channels (Ca 2+ channels) in neurons. Grammotoxin is also known as omega-grammotoxin SIA. Chemistry Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from ''Grammostola spatulata'' venom by reverse phase high performance liquid chromatography. Mode of action The toxin binding site on the channels has high affinity for the toxins when they are closed and low affinity when channels are activated. As a result, the toxin p ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Nanomolar
Molar concentration (also called molarity, amount concentration or substance concentration) is a measure of the concentration of a chemical species, in particular of a solute in a solution, in terms of amount of substance per unit volume of solution. In chemistry, the most commonly used unit for molarity is the number of moles per liter, having the unit symbol mol/L or mol/ dm3 in SI unit. A solution with a concentration of 1 mol/L is said to be 1 molar, commonly designated as 1 M. Definition Molar concentration or molarity is most commonly expressed in units of moles of solute per litre of solution. For use in broader applications, it is defined as amount of substance of solute per unit volume of solution, or per unit volume available to the species, represented by lowercase c: :c = \frac = \frac = \frac. Here, n is the amount of the solute in moles, N is the number of constituent particles present in volume V (in litres) of the solution, and N_\text is the Avo ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Neurohypophyseal
The posterior pituitary (or neurohypophysis) is the posterior lobe of the pituitary gland which is part of the endocrine system. The posterior pituitary is not glandular as is the anterior pituitary. Instead, it is largely a collection of axonal projections from the hypothalamus that terminate behind the anterior pituitary, and serve as a site for the secretion of neurohypophysial hormones ( oxytocin and vasopressin) directly into the blood. The hypothalamic–neurohypophyseal system is composed of the hypothalamus (the paraventricular nucleus and supraoptic nucleus), posterior pituitary, and these axonal projections. Structure The posterior pituitary consists mainly of neuronal projections (axons) of magnocellular neurosecretory cells extending from the supraoptic and paraventricular nuclei of the hypothalamus. These axons store and release neurohypophysial hormones oxytocin and vasopressin into the neurohypophyseal capillaries, from there they get into the systemic circula ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Theaflavin-3-gallate
Theaflavin-3-gallate is a theaflavin derivative. It can be found in abundance in black tea and is produced during fermentation. It has been studied as a cancer-fighting chemical when combined with cisplatin against ovarian cancer cells. Consuming large amounts of black tea has been reported to reduce the effects of aging in female populations.Y. Oka, S. Iwai, H. Amano et al., “Tea polyphenols inhibit rat osteoclast formation and differentiation,” ''Journal of Pharmacological Sciences'' 118 (1): 55–64, 2012. See also * List of phytochemicals in food While there is ample evidence to indicate the health benefits of diets rich in fruits, vegetables, legumes, whole grains and nuts, no specific food has been acknowledged by scientists and government regulatory authorities as providing a health bene ... References Thearubigins Tropolones Pyrogallols Benzoate esters Enediols {{Aromatic-stub ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Neurotransmitter
A neurotransmitter is a signaling molecule secreted by a neuron to affect another cell across a synapse. The cell receiving the signal, any main body part or target cell, may be another neuron, but could also be a gland or muscle cell. Neurotransmitters are released from synaptic vesicles into the synaptic cleft where they are able to interact with neurotransmitter receptors on the target cell. The neurotransmitter's effect on the target cell is determined by the receptor it binds. Many neurotransmitters are synthesized from simple and plentiful precursors such as amino acids, which are readily available and often require a small number of biosynthetic steps for conversion. Neurotransmitters are essential to the function of complex neural systems. The exact number of unique neurotransmitters in humans is unknown, but more than 100 have been identified. Common neurotransmitters include glutamate, GABA, acetylcholine, glycine and norepinephrine. Mechanism and cycle Synthes ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Neuropathic Pain
Neuropathic pain is pain caused by damage or disease affecting the somatosensory system. Neuropathic pain may be associated with abnormal sensations called dysesthesia or pain from normally non-painful stimuli (allodynia). It may have continuous and/or episodic (paroxysmal) components. The latter resemble stabbings or electric shocks. Common qualities include burning or coldness, "pins and needles" sensations, numbness and itching. Up to 7%-8% of the European population is affected, and in 5% of persons it may be severe. Neuropathic pain may result from disorders of the peripheral nervous system or the central nervous system (brain and spinal cord). Thus, neuropathic pain may be divided into peripheral neuropathic pain, central neuropathic pain, or mixed (peripheral and central) neuropathic pain. Neuropathic pain may occur in isolation or in combination with other forms of pain. Medical treatments focus on identifying the underlying cause and relieving pain. In cases of neuropathy ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Posterior Horn Of Spinal Cord
The posterior grey column (posterior cornu, dorsal horn, spinal dorsal horn, posterior horn, sensory horn) of the spinal cord is one of the three grey columns of the spinal cord. It receives several types of sensory information from the body, including fine touch, proprioception, and vibration. This information is sent from receptors of the skin, bones, and joints through sensory neurons whose cell bodies lie in the dorsal root ganglion. Anatomy The posterior grey column is subdivided into six layers termed Rexed laminae I-VI *Marginal nucleus of spinal cord (lamina I) *Substantia gelatinosa of Rolando (lamina II) *Nucleus proprius (laminae III, IV) *Spinal lamina V, the neck of the posterior horn *Spinal lamina VI, the base of the posterior horn. The other four Rexed laminae are located in the other two grey columns in the spinal cord. Additional images File:Gray687.png, Section of the medulla oblongata through the lower part of the decussation of the pyramids See also * ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Therapy
A therapy or medical treatment (often abbreviated tx, Tx, or Tx) is the attempted remediation of a health problem, usually following a medical diagnosis. As a rule, each therapy has indications and contraindications. There are many different types of therapy. Not all therapies are effective. Many therapies can produce unwanted adverse effects. ''Medical treatment'' and ''therapy'' are generally considered synonyms. However, in the context of mental health, the term ''therapy'' may refer specifically to psychotherapy. History Before the creating of therapy as a formal procedure, people told stories to one another to inform and assist about the world. The term "healing through words" was used over 3,500 years ago in Greek and Egyptian writing. The term psychotherapy was invented in the 19th century, and psychoanalysis was founded by Sigmund Freud under a decade later. Semantic field The words ''care'', ''therapy'', ''treatment'', and ''intervention'' overlap in a s ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
