NMB Allstars , a Japanese music group
{{disambig ...
NMB may stand for: * National Mediation Board, an independent agency of the U.S. government * The Neal Morse Band, stylized as NMB since 2021 *Nelson Mandela Bay Metropolitan Municipality, a metropolitan municipality in Eastern Cape, South Africa *Neuromedin B, a peptide in mammals *New methylene blue, an organic staining agent *NMB Technologies, a subsidiary of MinebeaMitsumi *North Miami Beach, Florida, a city in the U.S. *Daman Airport, Daman and Diu, India, IATA airport code NMB * NMB (Tanzania), a bank * NMB Bank Nepal * NMB Bank Limited, Zimbabwe * Big Nambas language, ISO 639 code nmb See also * *NMB48 NMB48 (read "N.M.B. Forty-eight") is a Japanese idol group that debuted in 2011 as the second sister group to AKB48, produced by Yasushi Akimoto. NMB48 is named after the Namba district in Osaka city of Osaka Prefecture, where the group is base ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
National Mediation Board
The National Mediation Board (NMB) is an independent agency of the United States government that coordinates labor-management relations within the U.S. railroads and airlines industries. History The board was established by the 1934 amendments to the Railway Labor Act of 1926 and is headed by a three-person panel of Presidential appointees. NMB programs provide an integrated dispute resolution process to meet the statutory objective of minimizing strikes and other work stoppages in the airline and railroad industries. The NMB's integrated processes specifically are designed to promote three statutory goals: * The prompt and orderly resolution of disputes arising out of the negotiation of new or revised collective bargaining agreements; * The effectuation of employee rights of self-organization where a representation dispute exists; and * The prompt and orderly resolution of disputes over the interpretation or application of existing agreements. Contracts Under the Railway Labor ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Neal Morse
Neal Morse (born August 2, 1960) is an American singer, musician and composer based in Nashville, Tennessee. In 1992, he formed the progressive rock band Spock's Beard with his brother Alan and released an album which was moderately successful. In 1999, he joined Dream Theater's co-founder and then drummer Mike Portnoy, together with Flower Kings' Roine Stolt and Marillion's Pete Trewavas they formed the super-group Transatlantic. In 2002, Neal Morse became a born again Christian, left Spock's Beard and began a Christian rock solo career, releasing many progressive rock concept albums about his new religious faith. In the meantime, he continued to play with Transatlantic and formed three new bands with Portnoy, Yellow Matter Custard, Flying Colors and The Neal Morse Band. Biography Band career Morse grew up in the San Fernando Valley of Los Angeles as one of four children. His father was a choral director. Morse started to play the piano at the age of five and started ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Nelson Mandela Bay Metropolitan Municipality
Nelson Mandela Bay Municipality ( af, Nelson Mandelabaai Metropolitaanse Munisipaliteit; xh, uMasipala wase Nelson Mandela Bay or ''uMasipala waseBhayi'') is one of eight metropolitan municipalities (also called Category A municipalities) in South Africa. It is located on the shores of Algoa Bay in the Eastern Cape Province and comprises the city of Port Elizabeth (Gqeberha), the nearby towns of Uitenhage and Despatch, and the surrounding rural area. The name "Nelson Mandela Bay Municipality" was chosen to honour former President Nelson Mandela. History Established on 5 December 2000, the Nelson Mandela Bay Metropolitan Municipality was formed as an administrative area covering Port Elizabeth (Gqeberha), the neighbouring towns of Kariega (Uitenhage) and Despatch and the surrounding agricultural areas. Thus included the following cities/towns/villages:Statistics South Africa''Nelson Mandela Bay'' ''www.statssa.gov.za'' Demographics and statistics As of the census of 2011, ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Metropolitan Municipality (South Africa)
In South Africa, a metropolitan municipality or Category A municipality is a municipality which executes all the functions of local government for a city or conurbation. This is by contrast to areas which are primarily rural, where the local government is divided into district municipalities and local municipalities. The Constitution A constitution is the aggregate of fundamental principles or established precedents that constitute the legal basis of a polity, organisation or other type of entity and commonly determine how that entity is to be governed. When these princip ..., section 155.1.a, defines "Category A" municipalities. In the Municipal Structures Act it is laid out that this type of local government is to be used for conurbations, "centre of economic activity", areas "for which integrated development planning is desirable", and areas with "strong interdependent social and economic linkages". The metropolitan municipality is similar to the consolidated city ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Eastern Cape
The Eastern Cape is one of the provinces of South Africa. Its capital is Bhisho, but its two largest cities are East London and Gqeberha. The second largest province in the country (at 168,966 km2) after Northern Cape, it was formed in 1994 out of the Xhosa homelands or bantustans of Transkei and Ciskei, together with the eastern portion of the Cape Province. The central and eastern part of the province is the traditional home of the indigenous Xhosa people. In 1820 this area which was known as the Xhosa Kingdom began to be settled by Europeans who originally came from England and some from Scotland and Ireland. Since South Africa's early years, many Xhosas believed in Africanism and figures such as Walter Rubusana believed that the rights of Xhosa people and Africans in general, could not be protected unless Africans mobilized and worked together. As a result, the Eastern Cape is home to many anti-apartheid leaders such as Robert Sobukwe, Oliver Tambo, Nelson Mandela ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
South Africa
South Africa, officially the Republic of South Africa (RSA), is the southernmost country in Africa. It is bounded to the south by of coastline that stretch along the South Atlantic and Indian Oceans; to the north by the neighbouring countries of Namibia, Botswana, and Zimbabwe; and to the east and northeast by Mozambique and Eswatini. It also completely enclaves the country Lesotho. It is the southernmost country on the mainland of the Old World, and the second-most populous country located entirely south of the equator, after Tanzania. South Africa is a biodiversity hotspot, with unique biomes, plant and animal life. With over 60 million people, the country is the world's 24th-most populous nation and covers an area of . South Africa has three capital cities, with the executive, judicial and legislative branches of government based in Pretoria, Bloemfontein, and Cape Town respectively. The largest city is Johannesburg. About 80% of the population are Black Sou ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Neuromedin B
Neuromedin B (NMB) is a bombesin-related peptide in mammals. It was originally purified from pig spinal cord, and later shown to be present in human central nervous system and gastrointestinal tract. Sequence The sequence of the C-terminal decapeptide is highly conserved across mammalian species: GNLWATGHFM-(NH2); this decapeptide is sometimes noted as neuromedin B, but it is more accurately described as neuromedin B 23-32. The sequence of neuromedin B (in rat) is : TPFSWDLPEPRSRASKIRVHPRGNLWATGHFM-(NH2). Function Neuromedin regulates the following functions: * exocrine and endocrine secretions * cell growth * body temperature * blood pressure and glucose level * sneezing Neuromedin signaling pathway NMB acts by binding to its high affinity cell surface receptor, neuromedin B receptor (NMBR). This receptor is a G protein-coupled receptor with seven transmembrane spanning regions, hence the receptor is also denoted as a 7-transmembrane receptor (7-TMR). Upon binding ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
New Methylene Blue
is an organic compound of the thiazine class of heterocycles. It is used as a stain and as an antimicrobial agent. It is classified as an azine dye, and the chromophore is a cation, the anion is often unspecified. Applications NMB is a staining agent used in diagnostic cytopathology and histopathology, typically for staining immature red blood cells. It is a supravital stain. It is closely related to methylene blue, an older stain in wide use. Safety New methylene blue is toxic. Skin contact or inhalation should be avoided. See also * Methylene blue Methylthioninium chloride, commonly called methylene blue, is a salt used as a dye and as a medication. Methylene blue is a thiazine dye. As a medication, it is mainly used to treat methemoglobinemia by converting the ferric iron in hemoglobin ... References {{DEFAULTSORT:New Methylene Blue Biochemistry detection methods Thiazine dyes Vital stains Histology ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
NMB Technologies
is a Japanese multinational corporation and a major producer of machinery components and electronics devices. The company was founded as in 1951. As of June 30, 2019, MinebeaMitsumi comprises 121 consolidated subsidiaries and affiliates. NMB (USA) Inc. (Nippon Miniature Bearing) is an American holding company that manages Minebea's American subsidiaries. MinebeaMitsumi shares are listed on the Tokyo Stock Exchange and the Osaka Securities Exchange, the company is a constituent of the Nikkei 225 stock index. On January 27, 2017, Minebea acquired Mitsumi for $500 million and changed its name to MinebeaMitsumi. Minebea has the world's largest shares in 6 product areas such as ball bearings (65%) and pivot assemblies (65%). International Asian business accounts for 80% of Minebea's production and 50% of its sales. Major businesses and subsidiaries NMB Technologies Corporation NMB deals in manufacturing of: * Bearings ** Bearing-related products: *** pivot assemblies, prec ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
MinebeaMitsumi
is a Japanese multinational corporation and a major producer of machinery components and electronics devices. The company was founded as in 1951. As of June 30, 2019, MinebeaMitsumi comprises 121 consolidated subsidiaries and affiliates. NMB (USA) Inc. (Nippon Miniature Bearing) is an American holding company that manages Minebea's American subsidiaries. MinebeaMitsumi shares are listed on the Tokyo Stock Exchange and the Osaka Securities Exchange, the company is a constituent of the Nikkei 225 stock index. On January 27, 2017, Minebea acquired Mitsumi for $500 million and changed its name to MinebeaMitsumi. Minebea has the world's largest shares in 6 product areas such as ball bearings (65%) and pivot assemblies (65%). International Asian business accounts for 80% of Minebea's production and 50% of its sales. Major businesses and subsidiaries NMB Technologies Corporation NMB deals in manufacturing of: * Bearings ** Bearing-related products: *** pivot assemblies, ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
North Miami Beach, Florida
North Miami Beach (commonly referred to as NMB) is a city in Miami-Dade County, Florida, United States. Originally named "Fulford-by-the-Sea" in 1926 after Captain William H. Fulford of the U.S. Coast Guard, the city was renamed "North Miami Beach" in 1931. The population was 43,676 at the 2020 census. History The hurricane of 1926 essentially ended the South Florida real estate boom, and in an effort to alleviate their losses and the damage to the city, local residents came together as the Town of Fulford. In 1927, it was incorporated as the City of Fulford. Geography North Miami Beach is located in northeastern Miami-Dade County at . It is bordered to the southeast by the city of North Miami, to the southwest by unincorporated Golden Glades, to the west by the city of Miami Gardens, to the north by unincorporated Ojus, to the northeast by the city of Aventura, and to the east across the Intracoastal Waterway by the city of Sunny Isles Beach. U.S. Route 1 (Biscayne Bo ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |
|
Daman Airport
Daman Airport is a military airbase at Daman in the union territory of Dadra and Nagar Haveli and Daman and Diu. It is home to the Indian Coast Guard Air Station, Daman which provides ATC and parking facilities to Defence as well as civilian aircraft. History Daman Airport was built in the 1950s by the Government of Portuguese India. The TAIP (Portuguese India Airlines) commenced operations to Daman on 29 August 1955. TAIP linked Daman with Goa, Diu and Karachi until December 1961, when Daman was liberated by the Indian Armed Forces, with TAIP ceasing operations. The Indian Coast Guard deployed its first Dornier Squadron at Daman in January 1987 followed by its first full-fledged Air Station in October 1987. Structure Daman Airport has two intersecting asphalt runways. The main runway 03/21 is 5910 ft (1801 m) long and 45 m wide while the secondary runway 10/28 is 3284 ft (1001 m) long and 25 m wide. The airport is equipped with Airport Surveillance Ra ... [...More Info...]       [...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]   |