|
Morin (flavonoid)
Morin is a yellow chemical compound that can be isolated from ''Maclura pomifera'' (Osage orange), ''Maclura tinctoria'' (old fustic), and from leaves of ''Psidium guajava'' (common guava). In a preclinical ''in vitro'' study, morin was found to be a weak inhibitor of fatty acid synthase with an IC50 of 2.33 μM. Morin was also found to inhibit amyloid formation by islet amyloid polypeptide (or amylin) and disaggregate amyloid fibers. Morin exhibit inhibitory action against IgE-mediated allergic response. Morin treatment significantly down-regulated expressions of BLT2, NF-κB, and Th2-cytokine (TNF-α, IL-1β, IL-4, IL-6, and IL-13) in lungs of murine model of allergic asthma. Morin can be used to test for the presence of aluminium or tin in a solution, since it forms characteristically fluorescent coordination complexes with them. Glycosides * Morin-3-O-arabinoside Arabinose is an aldopentose – a monosaccharide containing five carbon atoms, and including an aldehy ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Maclura Pomifera
''Maclura pomifera'', commonly known as the Osage orange ( ), is a small deciduous tree or large shrub, native to the south-central United States. It typically grows about tall. The distinctive fruit, a multiple fruit, is roughly spherical, bumpy, in diameter, and turns bright yellow-green in the fall. The fruits secrete a sticky white latex when cut or damaged. Despite the name "Osage orange", it is not related to the orange. It is a member of the mulberry family, Moraceae. Due to its latex secretions and woody pulp, the fruit is typically not eaten by humans and rarely by foraging animals. Controversial suggestions have been made that it was consumed by extinct Pleistocene megafauna, but these claims have been criticised as lacking empirical evidence. ''Maclura pomifera'' has many names, including mock orange, hedge apple, hedge, horse apple, monkey ball, monkey brains and yellow-wood. The name bois d'arc (from French meaning "bow-wood") has also been corrupted into ''bodar ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Maclura Tinctoria
''Maclura tinctoria'', known as old fustic and dyer's mulberry, is a medium to large tree of the Neotropics, from Mexico to Argentina. It produces a yellow dye called fustic primarily known for coloring khaki fabric for U.S. military apparel during World War I. This dye contains the flavonoid morin. It is dioecious, so both male and female plants are needed to set seed. The leaves can be used to feed silk worms. Old fustic is not to be confused with young fustic (''Rhus cotinus'') from southern Europe and Asia, which provides a more fugitive colour. Dyeing Fustic is a bright yellow dye that is very color-fast when used with mordants. It is frequently combined with other dyestuffs and various mordants to produce a range of yellow and greenish colors: * With woad or indigo: bright or Saxon greens * With bichromate of potash: old gold * With logwood and bichromate of potash: greenish yellows * With copper sulfate: olive greens * With ferrous sulfate Iron(II) sulfate (Brit ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Psidium Guajava
''Psidium guajava'', the common guava, yellow guava, lemon guava, or apple guava is an evergreen shrub or small tree native to the Caribbean, Central America and South America. It is easily pollinated by insects; when cultivated, it is pollinated mainly by the common honey bee, ''Apis mellifera''. Overview Widely cultivated in tropical and subtropical regions around the world, guava fruits can range in size from as small as an apricot to as large as a grapefruit. Various cultivars have white, pink, or red flesh; a few varieties feature red (instead of green or yellow) skin. When cultivated from seed, guavas are notable for their extremely slow growth rate for several months, before a very rapid acceleration in growth rate takes over. From seed, common guavas may bloom and set fruit in as few as two years or as many as eight. Cuttings, grafting, and air layering are more commonly used as a propagation method in commercial groves. Highly adaptable, guavas can be easily grown a ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
In Vitro
''In vitro'' (meaning in glass, or ''in the glass'') studies are performed with microorganisms, cells, or biological molecules outside their normal biological context. Colloquially called "test-tube experiments", these studies in biology and its subdisciplines are traditionally done in labware such as test tubes, flasks, Petri dishes, and microtiter plates. Studies conducted using components of an organism that have been isolated from their usual biological surroundings permit a more detailed or more convenient analysis than can be done with whole organisms; however, results obtained from ''in vitro'' experiments may not fully or accurately predict the effects on a whole organism. In contrast to ''in vitro'' experiments, ''in vivo'' studies are those conducted in living organisms, including humans, and whole plants. Definition ''In vitro'' ( la, in glass; often not italicized in English usage) studies are conducted using components of an organism that have been isolated fro ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Fatty Acid Synthase
Fatty acid synthase (FAS) is an enzyme that in humans is encoded by the ''FASN'' gene. Fatty acid synthase is a multi-enzyme protein that catalyzes fatty acid synthesis. It is not a single enzyme but a whole enzymatic system composed of two identical 272 kDa multifunctional polypeptides, in which substrates are handed from one functional domain to the next. Its main function is to catalyze the synthesis of palmitate (C16:0, a long-chain saturated fatty acid) from acetyl-CoA and malonyl-CoA, in the presence of NADPH. The fatty acids are synthesized by a series of decarboxylative Claisen condensation reactions from acetyl-CoA and malonyl-CoA. Following each round of elongation the beta keto group is reduced to the fully saturated carbon chain by the sequential action of a ketoreductase (KR), dehydratase (DH), and enoyl reductase (ER). The growing fatty acid chain is carried between these active sites while attached covalently to the phosphopantetheine prosthetic group of ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
IC50
The half maximal inhibitory concentration (IC50) is a measure of the potency of a substance in inhibiting a specific biological or biochemical function. IC50 is a quantitative measure that indicates how much of a particular inhibitory substance (e.g. drug) is needed to inhibit, ''in vitro'', a given biological process or biological component by 50%. The biological component could be an enzyme, cell, cell receptor or microorganism. IC50 values are typically expressed as molar concentration. IC50 is commonly used as a measure of antagonist drug potency in pharmacological research. IC50 is comparable to other measures of potency, such as EC50 for excitatory drugs. EC50 represents the dose or plasma concentration required for obtaining 50% of a maximum effect ''in vivo''. IC50 can be determined with functional assays or with competition binding assays. Sometimes, IC50 values are converted to the pIC50 scale. :\ce = -\log_ \ce Due to the minus sign, higher values of pIC50 indica ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Amyloid
Amyloids are aggregates of proteins characterised by a Fibril, fibrillar morphology of 7–13 Nanometer, nm in diameter, a beta sheet (β-sheet) Secondary structure of proteins, secondary structure (known as cross-β) and ability to be Staining, stained by particular dyes, such as Congo red. In the human body, amyloids have been linked to the development of various diseases. Pathogenic amyloids form when previously healthy proteins lose their normal Protein structure, structure and physiology, physiological functions (Protein misfolding, misfolding) and form fibrous deposits in amyloid plaques around cells which can disrupt the healthy function of tissues and organs. Such amyloids have been associated with (but not necessarily as the cause of) more than 50 human diseases, known as amyloidosis, and may play a role in some neurodegenerative diseases. Some of these diseases are mainly sporadic and only a few cases are Genetic disorder, familial. Others are only Genetic disorder, fam ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Islet Amyloid Polypeptide
Amylin, or islet amyloid polypeptide (IAPP), is a 37-residue peptide hormone. It is co-secreted with insulin from the pancreatic β-cells in the ratio of approximately 100:1 (insulin:amylin). Amylin plays a role in glycemic regulation by slowing gastric emptying and promoting satiety, thereby preventing post-prandial spikes in blood glucose levels. IAPP is processed from an 89-residue coding sequence. Proislet amyloid polypeptide (proIAPP, proamylin, proislet protein) is produced in the pancreatic beta cells (β-cells) as a 67 amino acid, 7404 Dalton pro-peptide and undergoes post-translational modifications including protease cleavage to produce amylin. Synthesis ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYL ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Aluminium
Aluminium (aluminum in American and Canadian English) is a chemical element with the symbol Al and atomic number 13. Aluminium has a density lower than those of other common metals, at approximately one third that of steel. It has a great affinity towards oxygen, and forms a protective layer of oxide on the surface when exposed to air. Aluminium visually resembles silver, both in its color and in its great ability to reflect light. It is soft, non-magnetic and ductile. It has one stable isotope, 27Al; this isotope is very common, making aluminium the twelfth most common element in the Universe. The radioactivity of 26Al is used in radiodating. Chemically, aluminium is a post-transition metal in the boron group; as is common for the group, aluminium forms compounds primarily in the +3 oxidation state. The aluminium cation Al3+ is small and highly charged; as such, it is polarizing, and bonds aluminium forms tend towards covalency. The strong affinity tow ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Fluorescence
Fluorescence is the emission of light by a substance that has absorbed light or other electromagnetic radiation. It is a form of luminescence. In most cases, the emitted light has a longer wavelength, and therefore a lower photon energy, than the absorbed radiation. A perceptible example of fluorescence occurs when the absorbed radiation is in the ultraviolet region of the electromagnetic spectrum (invisible to the human eye), while the emitted light is in the visible region; this gives the fluorescent substance a distinct color that can only be seen when the substance has been exposed to UV light. Fluorescent materials cease to glow nearly immediately when the radiation source stops, unlike phosphorescent materials, which continue to emit light for some time after. Fluorescence has many practical applications, including mineralogy, gemology, medicine, chemical sensors (fluorescence spectroscopy), fluorescent labelling, dyes, biological detectors, cosmic-ray detection, vacu ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Coordination Complex
A coordination complex consists of a central atom or ion, which is usually metallic and is called the ''coordination centre'', and a surrounding array of bound molecules or ions, that are in turn known as ''ligands'' or complexing agents. Many metal-containing compounds, especially those that include transition metals (elements like titanium that belong to the Periodic Table's d-block), are coordination complexes. Nomenclature and terminology Coordination complexes are so pervasive that their structures and reactions are described in many ways, sometimes confusingly. The atom within a ligand that is bonded to the central metal atom or ion is called the donor atom. In a typical complex, a metal ion is bonded to several donor atoms, which can be the same or different. A polydentate (multiple bonded) ligand is a molecule or ion that bonds to the central atom through several of the ligand's atoms; ligands with 2, 3, 4 or even 6 bonds to the central atom are common. These compl ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Arabinoside
Arabinose is an aldopentose – a monosaccharide containing five carbon atoms, and including an aldehyde (CHO) functional group. For biosynthetic reasons, most saccharides are almost always more abundant in nature as the "D"-form, or structurally analogous to glyceraldehyde, D-glyceraldehyde.The D/L nomenclature does not refer to the molecule's optical rotation properties but to its structural analogy to glyceraldehyde. However, L-arabinose is in fact more common than D-arabinose in nature and is found in nature as a component of biopolymers such as hemicellulose and pectin. The L-arabinose operon, L-arabinose operon, also known as the araBAD operon, has been the subject of much biomolecular research. The operon directs the catabolism of arabinose in Escherichia coli, ''E. coli'', and it is dynamically activated in the presence of arabinose and the absence of glucose. A classic method for the organic synthesis of arabinose from glucose is the Wohl degradation. : Etymology Arab ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
