|
James H. Fallon
James H. "Jim" Fallon (born October 18, 1947) is an American neuroscientist. He is professor of psychiatry and human behavior and emeritus professor of anatomy and neurobiology in the University of California, Irvine School of Medicine. His research interests include adult stem cells, chemical neuroanatomy and circuitry, higher brain functions, and brain imaging. Fallon, who states that he has the neurological and genetic correlates of psychopathy, has categorized himself as a "pro-social psychopath". In October 2013 his book, ''The Psychopath Inside: A Neuroscientist's Personal Journey into the Dark Side of the Brain'', was released by Current (acquired by Penguin). Family James Fallon was born to an Italian American family. He also has English and Irish ancestry through New York colonial settler Thomas Cornell, who was convicted of murdering his mother and hanged in 1667. Fallon mentions the many murders that have occurred in the Cornell family line he shares with Lizzie Bor ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Neuroscientist
A neuroscientist (or neurobiologist) is a scientist who has specialised knowledge in neuroscience, a branch of biology that deals with the physiology, biochemistry, psychology, anatomy and molecular biology of neurons, Biological neural network, neural circuits, and glial cells and especially their Behavior, behavioral, Biology, biological, and psychological aspect in health and disease. Neuroscientists generally work as researchers within a college, university, government agency, or private Private industry, industry setting. In research-oriented careers, neuroscientists typically spend their time designing and carrying out scientific experiments that contribute to the understanding of the nervous system and its function. They can engage in basic or applied research. Basic research seeks to add information to our current understanding of the nervous system, whereas applied research seeks to address a specific problem, such as developing a treatment for a neurological disorder. ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Psychology
Psychology is the scientific study of mind and behavior. Psychology includes the study of conscious and unconscious phenomena, including feelings and thoughts. It is an academic discipline of immense scope, crossing the boundaries between the natural and social sciences. Psychologists seek an understanding of the emergent properties of brains, linking the discipline to neuroscience. As social scientists, psychologists aim to understand the behavior of individuals and groups.Fernald LD (2008)''Psychology: Six perspectives'' (pp.12–15). Thousand Oaks, CA: Sage Publications.Hockenbury & Hockenbury. Psychology. Worth Publishers, 2010. Ψ (''psi''), the first letter of the Greek word ''psyche'' from which the term psychology is derived (see below), is commonly associated with the science. A professional practitioner or researcher involved in the discipline is called a psychologist. Some psychologists can also be classified as behavioral or cognitive scientists. Some psyc ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Parkinson's Disease
Parkinson's disease (PD), or simply Parkinson's, is a long-term degenerative disorder of the central nervous system that mainly affects the motor system. The symptoms usually emerge slowly, and as the disease worsens, non-motor symptoms become more common. The most obvious early symptoms are tremor, rigidity, slowness of movement, and difficulty with walking. Cognitive and behavioral problems may also occur with depression, anxiety, and apathy occurring in many people with PD. Parkinson's disease dementia becomes common in the advanced stages of the disease. Those with Parkinson's can also have problems with their sleep and sensory systems. The motor symptoms of the disease result from the death of cells in the substantia nigra, a region of the midbrain, leading to a dopamine deficit. The cause of this cell death is poorly understood, but involves the build-up of misfolded proteins into Lewy bodies in the neurons. Collectively, the main motor symptoms are also known as ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Schizophrenia
Schizophrenia is a mental disorder characterized by continuous or relapsing episodes of psychosis. Major symptoms include hallucinations (typically hearing voices), delusions, and disorganized thinking. Other symptoms include social withdrawal, decreased emotional expression, and apathy. Symptoms typically develop gradually, begin during young adulthood, and in many cases never become resolved. There is no objective diagnostic test; diagnosis is based on observed behavior, a history that includes the person's reported experiences, and reports of others familiar with the person. To be diagnosed with schizophrenia, symptoms and functional impairment need to be present for six months (DSM-5) or one month (ICD-11). Many people with schizophrenia have other mental disorders, especially substance use disorders, depressive disorders, anxiety disorders, and obsessive–compulsive disorder. About 0.3% to 0.7% of people are diagnosed with schizophrenia during their lifetime. In 2 ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Epidermal Growth Factor
Epidermal growth factor (EGF) is a protein that stimulates cell growth and differentiation by binding to its receptor, EGFR. Human EGF is 6-k Da and has 53 amino acid residues and three intramolecular disulfide bonds. EGF was originally described as a secreted peptide found in the submaxillary glands of mice and in human urine. EGF has since been found in many human tissues, including platelets, submandibular gland (submaxillary gland), and parotid gland. Initially, human EGF was known as urogastrone. Structure In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42). Function EGF, via binding to its cognate receptor, results in cellular proliferation, differentiation, and survival. Salivary EGF, which seems to be regulated by dietary inorganic iodine, also plays an important physiological role in the maintenance of ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
TGF Alpha
Transforming growth factor alpha (TGF-α) is a protein that in humans is encoded by the TGFA gene. As a member of the epidermal growth factor (EGF) family, TGF-α is a mitogenic polypeptide. The protein becomes activated when binding to receptors capable of protein kinase activity for cellular signaling. TGF-α is a transforming growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Synthesis TGF-α is synthesized internally as part of a 160 (human) or 159 (rat) amino acid transmembrane precursor.Ferrer, I.; Alcantara, S.; Ballabriga, J.; Olive, M.; Blanco, R.; Rivera, R.; Carmona, M.; Berruezo, M.; Pitarch, S.; Planas, A. Transforming growth factor- α (TGF-α) and epide ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
National Institutes Of Health
The National Institutes of Health, commonly referred to as NIH (with each letter pronounced individually), is the primary agency of the United States government responsible for biomedical and public health research. It was founded in the late 1880s and is now part of the United States Department of Health and Human Services. The majority of NIH facilities are located in Bethesda, Maryland, and other nearby suburbs of the Washington metropolitan area, with other primary facilities in the Research Triangle Park in North Carolina and smaller satellite facilities located around the United States. The NIH conducts its own scientific research through the NIH Intramural Research Program (IRP) and provides major biomedical research funding to non-NIH research facilities through its Extramural Research Program. , the IRP had 1,200 principal investigators and more than 4,000 postdoctoral fellows in basic, translational, and clinical research, being the largest biomedical research instit ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Fulbright Fellow
The Fulbright Program, including the Fulbright–Hays Program, is one of several United States Cultural Exchange Programs with the goal of improving intercultural relations, cultural diplomacy, and intercultural competence between the people of the United States and other countries, through the exchange of persons, knowledge, and skills. Via the program, competitively-selected American citizens including students, scholars, teachers, professionals, scientists, and artists may receive scholarships or grants to study, conduct research, teach, or exercise their talents abroad; and citizens of other countries may qualify to do the same in the United States. The program was founded by United States Senator J. William Fulbright in 1946 and is considered to be one of the most widely recognized and prestigious scholarships in the world. The program provides approximately 8,000 grants annually – roughly 1,600 to U.S. students, 1,200 to U.S. scholars, 4,000 to foreign students, 900 to f ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Sloan Scholar
The Sloan Research Fellowships are awarded annually by the Alfred P. Sloan Foundation since 1955 to "provide support and recognition to early-career scientists and scholars". This program is one of the oldest of its kind in the United States. Fellowships were initially awarded in physics, chemistry, and mathematics. Awards were later added in neuroscience (1972), economics (1980), computer science (1993), computational and evolutionary molecular biology (2002), and ocean sciences or earth systems sciences (2012). Winners of these two-year fellowships are awarded $75,000, which may be spent on any expense supporting their research. From 2012 through 2020, the foundation awarded 126 research fellowship each year; in 2021, 128 were awarded, and 118 were awarded in 2022. Eligibility and selection To be eligible, a candidate must hold a Ph.D. or equivalent degree and must be a member of the faculty of a college, university, or other degree-granting institution in the United S ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
UC Irvine
UC may refer to: Arts and entertainment * ''University Challenge'', a popular British quiz programme airing on BBC Two ** '' University Challenge (New Zealand)'', the New Zealand version of the British programme * Universal Century, one of the timelines of the ''Gundam'' anime metaseries Education In the United States * University of California system ** University of California, Berkeley, its flagship university * University of Charleston, West Virginia * University of Chicago, Illinois * University of Cincinnati, Ohio * Upsala College, East Orange, New Jersey (''defunct since 1995'') * Utica College, Utica, New York * Harvard Undergraduate Council, Harvard College's student government body * University college In other countries * Pontifical Catholic University of Chile * University of Canberra, Australia * University of Cantabria, Spain * University of Canterbury, New Zealand * University of Cebu, Cebu City, Philippines * University of Coimbra, Portugal * University of the Co ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
UC San Diego
The University of California, San Diego (UC San Diego or colloquially, UCSD) is a public university, public Land-grant university, land-grant research university in San Diego, California. Established in 1960 near the pre-existing Scripps Institution of Oceanography, UC San Diego is the southernmost of the ten campuses of the University of California, and offers over 200 undergraduate and graduate degree programs, enrolling 33,096 undergraduate and 9,872 graduate students. The university occupies near the coast of the Pacific Ocean, with the main campus resting on approximately . UC San Diego is ranked among the best universities in the world by major college and university rankings. UC San Diego consists of twelve undergraduate, graduate and professional schools as well as seven undergraduate residential colleges. It received over 140,000 applications for undergraduate admissions in Fall 2021, making it the second most applied-to university in the United States. UC San Diego H ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
University Of Illinois College Of Medicine
The University of Illinois College of Medicine offers a four-year program leading to the MD degree at four different sites in Illinois: Chicago, Peoria, Illinois, Peoria, Rockford, Illinois, Rockford, and formerly Champaign–Urbana metropolitan area, Urbana–Champaign. The Urbana–Champaign site stopped accepting new students after Fall 2016 to make room for the newly established Carle Illinois College of Medicine. In 2011, enrollment of medical students in the University of Illinois system totaled 1,290 according to the Association of American Medical Colleges. History The College of Medicine, originally an independent institution, opened on September 26, 1882, as the College of Physicians and Surgeons of Chicago (P&S) with 100 students and a faculty of 30. Five years later, the Board of Trustees of the University of Illinois approved a contract of affiliation whereby the university would lease P&S as its Department of Medicine. The arrangement continued until 1912, when there ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
