|
Bukatoxin
Bukatoxin is an α- scorpion toxin found in the venom of the Chinese scorpion ''Buthus martensi'' Karsch. By blocking the inactivation of sodium ion channels, α-scorpion toxins prolong action potentials. Sources Bukatoxin (short names: BukaTx or BKTx, alternative name: BuK-alpha-Tx) is a neurotoxin that is expressed and secreted by the venom gland of the scorpion ''Buthus martensii'' Karsch (Chinese Scorpion). Chemistry Bukatoxin is a 65-residue peptide with the amino acid sequence VRDGYIADDKNCAYFCGRNAYCDEECIINGAESGYCQQAGVYGNACWCYKLPDKVPIRVSGECQQ, and has four disulfide bridges (Cys12-Cys63, Cys16-Cys36, Cys22-Cys46, Cys26-Cys48). The molecular weight of the neurotoxin is 7.2 kDa.{{Cite web, url=https://www.uniprot.org/uniprot/P82815, title = Bukatoxin - Mesobuthus martensii (Manchurian scorpion) Bukatoxin is a member of the 4C-C scorpion toxin superfamily. It can be further categorized as a polypeptide gating modifier toxin that belongs to the α-subfamily of scorpion neuroto ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Chinese Scorpion
''Olivierus martensii'' is a species of scorpion in the family Buthidae. Its common names include Chinese scorpion,''Mesobuthus martensii'' (Manchurian scorpion) (''Buthus martensii'') UniProt Taxonomy database Manchurian scorpion, Chinese armor-tail scorpion and Chinese golden scorpion. Despite its common name, this scorpion is not only found in Manchuria or , but also in [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Mesobuthus Martensii
''Olivierus martensii'' is a species of scorpion in the family Buthidae. Its common names include Chinese scorpion,''Mesobuthus martensii'' (Manchurian scorpion) (''Buthus martensii'') Taxonomy database Manchurian scorpion, Chinese armor-tail scorpion and Chinese golden scorpion. Despite its common name, this scorpion is not only found in or , but also in |
Scorpion Toxin
Scorpion toxins are proteins found in the venom of scorpions. Their toxic effect may be mammal- or insect-specific and acts by binding with varying degrees of specificity to members of the Voltage-gated ion channel superfamily; specifically, voltage-gated sodium channels, voltage-gated potassium channels, and Transient Receptor Potential (TRP) channels. The result of this action is to activate or inhibit the action of these channels in the nervous and cardiac organ systems. For instance, α-scorpion toxins MeuNaTxα-12 and MeuNaTxα-13 from ''Mesobuthus eupeus'' are neurotoxins that target voltage-gated Na+ channels (Navs), inhibiting fast inactivation. ''In vivo'' assays of MeuNaTxα-12 and MeuNaTxα-13 effects on mammalian and insect Navs show differential potency. These recombinants (MeuNaTxα-12 and MeuNaTxα-13) exhibit their preferential affinity for mammalian and insect Na+ channels at the α-like toxins' active site, site 3, in order to inactivate the cell membrane depolari ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Scorpion Toxins
Scorpions are predatory arachnids of the order Scorpiones. They have eight legs, and are easily recognized by a pair of grasping pincers and a narrow, segmented tail, often carried in a characteristic forward curve over the back and always ending with a stinger. The evolutionary history of scorpions goes back 435 million years. They mainly live in deserts but have adapted to a wide range of environmental conditions, and can be found on all continents except Antarctica. There are over 2,500 described species, with 22 extant (living) families recognized to date. Their taxonomy is being revised to account for 21st-century genomic studies. Scorpions primarily prey on insects and other invertebrates, but some species hunt vertebrates. They use their pincers to restrain and kill prey, or to prevent their own predation. The venomous sting is used for offense and defense. During courtship, the male and female grasp each other's pincers and dance while he tries to move her onto his sp ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Corpus Cavernosum Penis
A corpus cavernosum penis (singular) (literally "cave-like body" of the penis, plural corpora cavernosa) is one of a pair of sponge-like regions of erectile tissue, which contain most of the blood in the penis during an erection. Such a corpus is homologous to the corpus cavernosum clitoridis in the female; the body of the clitoris that contains erectile tissue in a pair of corpora cavernosa with a recognisably similar structure. Anatomy The two corpora cavernosa and corpus spongiosum (also known as the ''corpus cavernosum urethrae'' in older texts and in the adjacent diagram) are three expandable erectile tissues along the length of the penis, which fill with blood during penile erection. The two corpora cavernosa lie along the penis shaft, from the pubic bones to the head of the penis, where they join. These formations are made of a sponge-like tissue containing trabeculae, irregular blood-filled spaces lined by endothelium and separated by septum of the penis. The male ana ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Transmembrane Protein
A transmembrane protein (TP) is a type of integral membrane protein that spans the entirety of the cell membrane. Many transmembrane proteins function as gateways to permit the transport of specific substances across the membrane. They frequently undergo significant conformational changes to move a substance through the membrane. They are usually highly hydrophobic and aggregate and precipitate in water. They require detergents or nonpolar solvents for extraction, although some of them (beta-barrels) can be also extracted using denaturing agents. The peptide sequence that spans the membrane, or the transmembrane segment, is largely hydrophobic and can be visualized using the hydropathy plot. Depending on the number of transmembrane segments, transmembrane proteins can be classified as single-span (or bitopic) or multi-span (polytopic). Some other integral membrane proteins are called monotopic, meaning that they are also permanently attached to the membrane, but do not pass ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Tripeptide
A tripeptide is a peptide derived from three amino acids joined by two or sometimes three peptide bonds. As for proteins, the function of peptides is determined by the constituent amino acids and their sequence. The simplest tripeptide is glycine. In terms of scientific investigations, the dominant tripeptide is glutathione (γ-L-Glutamyl-L-cysteinylglycine), which serves many roles in many forms of life. Examples * Eisenin (pGlu-Gln-Ala-OH) is a peptide with immunological activity that is isolated from the Japanese marine alga, ''Eisenia bicyclis'', which more commonly is known as Arame * GHK-Cu (glycyl-L-histidyl-L-lysine) is a human copper binding peptide with wound healing and skin remodeling activity, which is used in anti-aging cosmetics and more commonly referred to as copper peptide *Lactotripeptides (Ile-Pro-Pro and Val-Pro-Pro) found in milk products, act as ACE inhibitors *Leupeptin (''N''-acetyl-L-leucyl-L-leucyl-L-argininal) is a protease inhibitor that also acts as ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Peptide Sequence
Peptides (, ) are short chains of amino acids linked by peptide bonds. Long chains of amino acids are called proteins. Chains of fewer than twenty amino acids are called oligopeptides, and include dipeptides, tripeptides, and tetrapeptides. A polypeptide is a longer, continuous, unbranched peptide chain. Hence, peptides fall under the broad chemical classes of biological polymers and oligomers, alongside nucleic acids, oligosaccharides, polysaccharides, and others. A polypeptide that contains more than approximately 50 amino acids is known as a protein. Proteins consist of one or more polypeptides arranged in a biologically functional way, often bound to ligands such as coenzymes and cofactors, or to another protein or other macromolecule such as DNA or RNA, or to complex macromolecular assemblies. Amino acids that have been incorporated into peptides are termed residues. A water molecule is released during formation of each amide bond.. All peptides except cyclic pepti ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Receptor (biochemistry)
In biochemistry and pharmacology, receptors are chemical structures, composed of protein, that receive and transduce signals that may be integrated into biological systems. These signals are typically chemical messengers which bind to a receptor and cause some form of cellular/tissue response, e.g. a change in the electrical activity of a cell. There are three main ways the action of the receptor can be classified: relay of signal, amplification, or integration. Relaying sends the signal onward, amplification increases the effect of a single ligand, and integration allows the signal to be incorporated into another biochemical pathway. Receptor proteins can be classified by their location. Transmembrane receptors include ligand-gated ion channels, G protein-coupled receptors, and enzyme-linked hormone receptors. Intracellular receptors are those found inside the cell, and include cytoplasmic receptors and nuclear receptors. A molecule that binds to a receptor is called a ligand ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Taxonomic Rank
In biological classification, taxonomic rank is the relative level of a group of organisms (a taxon) in an ancestral or hereditary hierarchy. A common system consists of species, genus, family (biology), family, order (biology), order, class (biology), class, phylum (biology), phylum, kingdom (biology), kingdom, domain (biology), domain. While older approaches to taxonomic classification were phenomenological, forming groups on the basis of similarities in appearance, organic structure and behaviour, methods based on genetic analysis have opened the road to cladistics. A given rank subsumes under it less general categories, that is, more specific descriptions of life forms. Above it, each rank is classified within more general categories of organisms and groups of organisms related to each other through inheritance of phenotypic trait, traits or features from common ancestors. The rank of any ''species'' and the description of its ''genus'' is ''basic''; which means that to iden ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Peptide
Peptides (, ) are short chains of amino acids linked by peptide bonds. Long chains of amino acids are called proteins. Chains of fewer than twenty amino acids are called oligopeptides, and include dipeptides, tripeptides, and tetrapeptides. A polypeptide is a longer, continuous, unbranched peptide chain. Hence, peptides fall under the broad chemical classes of biological polymers and oligomers, alongside nucleic acids, oligosaccharides, polysaccharides, and others. A polypeptide that contains more than approximately 50 amino acids is known as a protein. Proteins consist of one or more polypeptides arranged in a biologically functional way, often bound to ligands such as coenzymes and cofactors, or to another protein or other macromolecule such as DNA or RNA, or to complex macromolecular assemblies. Amino acids that have been incorporated into peptides are termed residues. A water molecule is released during formation of each amide bond.. All peptides except cyclic pep ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Molecular Mass
The molecular mass (''m'') is the mass of a given molecule: it is measured in daltons (Da or u). Different molecules of the same compound may have different molecular masses because they contain different isotopes of an element. The related quantity relative molecular mass, as defined by IUPAC, is the ratio of the mass of a molecule to the unified atomic mass unit (also known as the dalton) and is unitless. The molecular mass and relative molecular mass are distinct from but related to the molar mass. The molar mass is defined as the mass of a given substance divided by the amount of a substance and is expressed in g/mol. That makes the molar mass an average of many particles or molecules, and the molecular mass the mass of one specific particle or molecule. The molar mass is usually the more appropriate figure when dealing with macroscopic (weigh-able) quantities of a substance. The definition of molecular weight is most authoritatively synonymous with relative molecular mass; ho ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
.svg "Click for more on -> Receptor (biochemistry)")
