|
Stentor Coeruleus
''Stentor coeruleus'' is a protist in the family Stentoridae which is characterized by being a very large ciliate that measures 0.5 to 2 millimetres when fully extended. ''Stentor coeruleus'' specifically appears as a very large trumpet. It contains a macronucleus that looks like a string of beads that are contained within a ciliate that is blue to blue-green in color. It has the ability to contract into a ball through the contraction of its many myonemes. It has the ability to swim while both fully extended or contracted. ''Stentor coeruleus'' is known for its regenerative abilities. When this organism is cut in half, each half is able to regenerate a half-sized cell that has its normal anatomy and will look the same way it did prior to being cut. It feeds by means of cilia that carry food into the gullet. DNA The genetic code is the "universal" code, and not the usual form Ciliate, dasycladacean and hexamita nuclear code, for ciliates. The introns are unusually small, only ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Protist
A protist () is any eukaryotic organism (that is, an organism whose cells contain a cell nucleus) that is not an animal, plant, or fungus. While it is likely that protists share a common ancestor (the last eukaryotic common ancestor), the exclusion of other eukaryotes means that protists do not form a natural group, or clade. Therefore, some protists may be more closely related to animals, plants, or fungi than they are to other protists. However, like the groups ''algae'', ''invertebrates'', and '' protozoans'', the biological category ''protist'' is used for convenience. Others classify any unicellular eukaryotic microorganism as a protist. The study of protists is termed protistology. History The classification of a third kingdom separate from animals and plants was first proposed by John Hogg in 1860 as the kingdom Protoctista; in 1866 Ernst Haeckel also proposed a third kingdom Protista as "the kingdom of primitive forms". Originally these also included prokaryotes, b ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Stentoridae
''Stentor'', sometimes called trumpet animalcules, are a genus of filter-feeding, heterotrophic ciliates, representative of the heterotrichs. They are usually horn-shaped, and reach lengths of two millimeters; as such, they are among the largest known extant unicellular organisms. They reproduce asexually through binary fission. Description The body, or cortex, is generally horn-shaped, hence the association with the Greek herald, and the former name "trumpet animalcule". A ring of prominent cilia around the anterior "bell" sweep in food and aid in swimming. Some reach several millimeters in length, making them among the largest single-celled organisms. ''Stentor'' can come in different colors: for example, ''S. coeruleus'' can appear blue due to the presence of stentorin, a natural pigment. As in many freshwater protozoans, ''Stentor'' has a contractile vacuole. Because the concentration of salt inside the cell and in the surrounding freshwater is different, ''Stentor'' must ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Ciliate
The ciliates are a group of alveolates characterized by the presence of hair-like organelles called cilia, which are identical in structure to flagellum, eukaryotic flagella, but are in general shorter and present in much larger numbers, with a different wikt:undulating, undulating pattern than flagella. Cilia occur in all members of the group (although the peculiar Suctoria only have them for part of their biological life cycle, life cycle) and are variously used in swimming, crawling, attachment, feeding, and sensation. Ciliates are an important group of protists, common almost anywhere there is water—in lakes, ponds, oceans, rivers, and soils. About 4,500 unique free-living species have been described, and the potential number of extant species is estimated at 27,000–40,000. Included in this number are many Ectosymbiosis, ectosymbiotic and endosymbiotic species, as well as some Obligate parasite, obligate and Facultative parasite, opportunistic parasites. Ciliate species r ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
English Pronounciation Of Stentor Coeruleus
English usually refers to: * English language * English people English may also refer to: Peoples, culture, and language * ''English'', an adjective for something of, from, or related to England ** English national identity, an identity and common culture ** English language in England, a variant of the English language spoken in England * English languages (other) * English studies, the study of English language and literature * ''English'', an Amish term for non-Amish, regardless of ethnicity Individuals * English (surname), a list of notable people with the surname ''English'' * People with the given name ** English McConnell (1882–1928), Irish footballer ** English Fisher (1928–2011), American boxing coach ** English Gardner (b. 1992), American track and field sprinter Places United States * English, Indiana, a town * English, Kentucky, an unincorporated community * English, Brazoria County, Texas, an unincorporated community * Engli ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Macronucleus
A macronucleus (formerly also meganucleus) is the larger type of nucleus in ciliates. Macronuclei are polyploid and undergo direct division without mitosis. It controls the non-reproductive cell functions, such as metabolism. During conjugation, the macronucleus disintegrates, and a new macronucleus is formed by karyogamy of the micronuclei. The macronucleus contains hundreds to thousands of chromosomes, each present in many copies. The macronucleus lacks a mechanism to precisely partition this complex genome equally during nuclear division; thus, how the cell manages to maintain a balanced genome after generations of divisions is unknown. See also *Micronucleus Micronucleus is the name given to the small nucleus that forms whenever a chromosome or a fragment of a chromosome is not incorporated into one of the daughter nuclei during cell division. It usually is a sign of genotoxic events and chromosomal i ... References . Cell nucleus Ciliate biology {{Ciliat ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Myoneme
A myoneme (or spasmoneme) is a contractile structure found in some eukaryotic single-celled organisms, particularly ''Vorticella''. It consists of a series of protein filaments that shorten rapidly upon exposure to calcium. Although the shortening can be up to 100 lengths per second, faster than any muscle, the relaxation time is several seconds (compared to approximately one tenth of a second for muscle). The myonemes of Acantharea The Acantharea (Acantharia) are a group of radiolarian protozoa, distinguished mainly by their strontium sulfate skeletons. Acantharians are heterotrophic marine microplankton that range in size from about 200 microns in diameter up to several ... also display slow contraction and undulation movements.{{cite journal, last=Febvre, first=Jean, title=The Myomene of the Acantharia (Protozoa): a new model of cellular motility, journal=BioSystems, year=1981, volume=14, issue=3-4, pages=327–336, doi=10.1016/0303-2647(81)90039-3 References Cell biolo ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Cilia
The cilium, plural cilia (), is a membrane-bound organelle found on most types of eukaryotic cell, and certain microorganisms known as ciliates. Cilia are absent in bacteria and archaea. The cilium has the shape of a slender threadlike projection that extends from the surface of the much larger cell body. Eukaryotic flagella found on sperm cells and many protozoans have a similar structure to motile cilia that enables swimming through liquids; they are longer than cilia and have a different undulating motion. There are two major classes of cilia: ''motile'' and ''non-motile'' cilia, each with a subtype, giving four types in all. A cell will typically have one primary cilium or many motile cilia. The structure of the cilium core called the axoneme determines the cilium class. Most motile cilia have a central pair of single microtubules surrounded by nine pairs of double microtubules called a 9+2 axoneme. Most non-motile cilia have a 9+0 axoneme that lacks the central pair of mi ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Genetic Code
The genetic code is the set of rules used by living cells to translate information encoded within genetic material ( DNA or RNA sequences of nucleotide triplets, or codons) into proteins. Translation is accomplished by the ribosome, which links proteinogenic amino acids in an order specified by messenger RNA (mRNA), using transfer RNA (tRNA) molecules to carry amino acids and to read the mRNA three nucleotides at a time. The genetic code is highly similar among all organisms and can be expressed in a simple table with 64 entries. The codons specify which amino acid will be added next during protein biosynthesis. With some exceptions, a three-nucleotide codon in a nucleic acid sequence specifies a single amino acid. The vast majority of genes are encoded with a single scheme (see the RNA codon table). That scheme is often referred to as the canonical or standard genetic code, or simply ''the'' genetic code, though variant codes (such as in mitochondria) exist. History Effor ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Ciliate, Dasycladacean And Hexamita Nuclear Code
The ciliate, dasycladacean and ''Hexamita'' nuclear code (translation table 6) is a genetic code used by certain ciliate, dasycladacean and ''Hexamita'' species. The ciliate macronuclear code has not been determined completely. The codon UAA is known to code for Gln only in the Oxytrichidae. The code : AAs = FFLLSSSSYYQQCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG : Starts = -----------------------------------M---------------------------- : Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG : Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG : Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U). Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleuc ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Introns
An intron is any nucleotide sequence within a gene that is not expressed or operative in the final RNA product. The word ''intron'' is derived from the term ''intragenic region'', i.e. a region inside a gene."The notion of the cistron .e., gene... must be replaced by that of a transcription unit containing regions which will be lost from the mature messenger – which I suggest we call introns (for intragenic regions) – alternating with regions which will be expressed – exons." (Gilbert 1978) The term ''intron'' refers to both the DNA sequence within a gene and the corresponding RNA sequence in RNA transcripts. The non-intron sequences that become joined by this RNA processing to form the mature RNA are called exons. Introns are found in the genes of most organisms and many viruses and they can be located in both protein-coding genes and genes that function as RNA (noncoding genes). There are four main types of introns: tRNA introns, group I introns, group II introns, and s ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Sexual Reproduction
Sexual reproduction is a type of reproduction that involves a complex life cycle in which a gamete ( haploid reproductive cells, such as a sperm or egg cell) with a single set of chromosomes combines with another gamete to produce a zygote that develops into an organism composed of cells with two sets of chromosomes ( diploid). This is typical in animals, though the number of chromosome sets and how that number changes in sexual reproduction varies, especially among plants, fungi, and other eukaryotes. Sexual reproduction is the most common life cycle in multicellular eukaryotes, such as animals, fungi and plants. Sexual reproduction also occurs in some unicellular eukaryotes. Sexual reproduction does not occur in prokaryotes, unicellular organisms without cell nuclei, such bacteria and archaea. However, some process in bacteria may be considered analogous to sexual reproduction in that they incorporate new genetic information, including bacterial conjugation, transformatio ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Sexual Conjugation
Isogamy is a form of sexual reproduction that involves gametes of the same morphology (indistinguishable in shape and size), found in most unicellular eukaryotes. Because both gametes look alike, they generally cannot be classified as male or female. Instead, organisms undergoing isogamy are said to have different mating types, most commonly noted as "+" and "−" strains. Etymology The literal meaning of isogamy is "equal marriage" which refers to equal contribution of resources by both gametes to a zygote. The term isogamous was first used in the year 1887. Characteristics of isogamous species Isogamous species often have two mating types. Some isogamous species have more than two mating types, but the number is usually lower than ten. In some extremely rare cases a species can have thousands of mating types. In all cases, fertilization occurs when gametes of two different mating types fuse to form a zygote. Evolution It is generally accepted that isogamy is an an ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
