Scorpio Maurus
   HOME
*





Scorpio Maurus
''Scorpio maurus'' is a species of North African and Middle Eastern scorpion, also known as the large-clawed scorpion or Israeli gold scorpion and lesser known as Zerachia scorpion. This is a small/medium-sized scorpion from the family Scorpionidae. It has brown back and golden claws. There are many sub-species of this scorpion, 19 of which were described by Fet et al. The venom of ''Scorpio maurus'' contains a high variety of toxins including proteases, phospholipases, protease inhibitors and potassium channel toxins δ-KTx. Although its venom contains a weak neurotoxin called maurotoxin, ''S. maurus'' is not a dangerous scorpion for humans. There are no records of fatalities. Habits Found in very deep burrows in deserts and occasionally sparse woodland. Its habit of creating very deep burrows (up to 1 metre deep) means that in captivity this scorpion is often happiest with higher humidity Humidity is the concentration of water vapor present in the air. Water vapo ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Carl Linnaeus
Carl Linnaeus (; 23 May 1707 – 10 January 1778), also known after his ennoblement in 1761 as Carl von Linné Blunt (2004), p. 171. (), was a Swedish botanist, zoologist, taxonomist, and physician who formalised binomial nomenclature, the modern system of naming organisms. He is known as the "father of modern taxonomy". Many of his writings were in Latin; his name is rendered in Latin as and, after his 1761 ennoblement, as . Linnaeus was born in Råshult, the countryside of Småland, in southern Sweden. He received most of his higher education at Uppsala University and began giving lectures in botany there in 1730. He lived abroad between 1735 and 1738, where he studied and also published the first edition of his ' in the Netherlands. He then returned to Sweden where he became professor of medicine and botany at Uppsala. In the 1740s, he was sent on several journeys through Sweden to find and classify plants and animals. In the 1750s and 1760s, he continued to collect an ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

10th Edition Of Systema Naturae
The 10th edition of ''Systema Naturae'' is a book written by Swedish naturalist Carl Linnaeus and published in two volumes in 1758 and 1759, which marks the starting point of zoological nomenclature. In it, Linnaeus introduced binomial nomenclature for animals, something he had already done for plants in his 1753 publication of '' Species Plantarum''. Starting point Before 1758, most biological catalogues had used polynomial names for the taxa included, including earlier editions of ''Systema Naturae''. The first work to consistently apply binomial nomenclature across the animal kingdom was the 10th edition of ''Systema Naturae''. The International Commission on Zoological Nomenclature therefore chose 1 January 1758 as the "starting point" for zoological nomenclature, and asserted that the 10th edition of ''Systema Naturae'' was to be treated as if published on that date. Names published before that date are unavailable, even if they would otherwise satisfy the rules. The only ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

North Africa
North Africa, or Northern Africa is a region encompassing the northern portion of the African continent. There is no singularly accepted scope for the region, and it is sometimes defined as stretching from the Atlantic shores of Mauritania in the west, to Egypt's Suez Canal. Varying sources limit it to the countries of Algeria, Libya, Morocco, and Tunisia, a region that was known by the French during colonial times as "''Afrique du Nord''" and is known by Arabs as the Maghreb ("West", ''The western part of Arab World''). The United Nations definition includes Morocco, Algeria, Tunisia, Libya, Egypt, Sudan, and the Western Sahara, the territory disputed between Morocco and the Sahrawi Republic. The African Union definition includes the Western Sahara and Mauritania but not Sudan. When used in the term Middle East and North Africa (MENA), it often refers only to the countries of the Maghreb. North Africa includes the Spanish cities of Ceuta and Melilla, and plazas de s ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Middle East
The Middle East ( ar, الشرق الأوسط, ISO 233: ) is a geopolitical region commonly encompassing Arabian Peninsula, Arabia (including the Arabian Peninsula and Bahrain), Anatolia, Asia Minor (Asian part of Turkey except Hatay Province), East Thrace (European part of Turkey), Egypt, Iran, the Levant (including Syria (region), Ash-Shām and Cyprus), Mesopotamia (modern-day Iraq), and the Socotra Governorate, Socotra Archipelago (a part of Yemen). The term came into widespread usage as a replacement of the term Near East (as opposed to the Far East) beginning in the early 20th century. The term "Middle East" has led to some confusion over its changing definitions, and has been viewed by some to be discriminatory or too Eurocentrism, Eurocentric. The region includes the vast majority of the territories included in the closely associated definition of Western Asia (including Iran), but without the South Caucasus, and additionally includes all of Egypt (not just the Sina ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Scorpion
Scorpions are predatory arachnids of the order Scorpiones. They have eight legs, and are easily recognized by a pair of grasping pincers and a narrow, segmented tail, often carried in a characteristic forward curve over the back and always ending with a stinger. The evolutionary history of scorpions goes back 435 million years. They mainly live in deserts but have adapted to a wide range of environmental conditions, and can be found on all continents except Antarctica. There are over 2,500 described species, with 22 extant (living) families recognized to date. Their taxonomy is being revised to account for 21st-century genomic studies. Scorpions primarily prey on insects and other invertebrates, but some species hunt vertebrates. They use their pincers to restrain and kill prey, or to prevent their own predation. The venomous sting is used for offense and defense. During courtship, the male and female grasp each other's pincers and dance while he tries to move her onto his s ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


Scorpionidae
The Scorpionidae (burrowing scorpions or pale-legged scorpions) make up the Taxonomic rank, superfamily Scorpionoidea. The family was established by Pierre André Latreille, 1802. Genera Scorpionidae contains the following genera: * ''Aops'' Volschenk & Prendini, 2008 * ''Chersonesometrus'' Couzijn, 1978 * ''Deccanometrus'' Prendini & Loria, 2020 * ''Gigantometrus'' Couzijn, 1978 * ''Heterometrus'' Ehrenberg, 1828 * ''Javanimetrus'' Couzijn, 1978 * ''Opistophthalmus'' C. L. Koch, 1837 * ''Pandiborellius'' Rossi, 2015 * ''Pandinoides'' Fet, 1997 * ''Pandinops'' Birula, 1913 * ''Pandinopsis'' Vachon, 1974 * ''Pandinurus'' Fet, 1997 * ''Pandinus'' Thorell, 1876 * ''Pandipalpus'' Rossi, 2015 * ''Sahyadrimetrus'' Prendini & Loria, 2020 * ''Scorpio (genus), Scorpio'' Linnaeus, 1758 * ''Srilankametrus'' Couzijn, 1981 * ''Urodacus'' Peters, 1861 References

Scorpionidae, Scorpion families Taxa named by Pierre André Latreille {{Scorpion-stub ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Claw
A claw is a curved, pointed appendage found at the end of a toe or finger in most amniotes (mammals, reptiles, birds). Some invertebrates such as beetles and spiders have somewhat similar fine, hooked structures at the end of the leg or tarsus for gripping a surface as they walk. The pincers of crabs, lobsters and scorpions, more formally known as their chelae, are sometimes called claws. A true claw is made of a hard protein called keratin. Claws are used to catch and hold prey in carnivorous mammals such as cats and dogs, but may also be used for such purposes as digging, climbing trees, self-defense and grooming, in those and other species. Similar appendages that are flat and do not come to a sharp point are called nails instead. Claw-like projections that do not form at the end of digits but spring from other parts of the foot are properly named spurs. Tetrapods In tetrapods, claws are made of keratin and consist of two layers. The unguis is the harder external layer, ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


Maurotoxin
Maurotoxin (abbreviated MTX) is a peptide toxin from the venom of the Tunisian chactoid scorpion '' Scorpio maurus palmatus'', from which it was first isolated and from which the chemical gets its name. It acts by blocking several types of voltage-gated potassium channel. Chemistry Maurotoxin is a peptide of 34 amino acids (sequence VSCTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC) cross-linked by four disulfide bridges (Cys3-Cys24, Cys9-Cys29, Cys13-Cys19, Cys31-Cys34), with an atypical pattern of organization compared with other scorpion toxins; this unusual pairing of cysteine residues may be mediated by the presence of adjacent prolines. The peptide contains an alpha helix linked by two disulfide bridges to a two-stranded antiparallel beta sheet. Target Scorpion toxins constitute the largest group of potassium (K+) channel blockers and are useful pharmacological probes to investigate ion channels and their functions. Maurotoxin (MTX) blocks various K+ -channels: * Apamin-sen ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

University Of California, Davis
The University of California, Davis (UC Davis, UCD, or Davis) is a public land-grant research university near Davis, California. Named a Public Ivy, it is the northernmost of the ten campuses of the University of California system. The institution was first founded as an agricultural branch of the system in 1905 and became the seventh campus of the University of California in 1959. The university is classified among "R1: Doctoral Universities – Very high research activity". The UC Davis faculty includes 23 members of the National Academy of Sciences, 30 members of the American Academy of Arts and Sciences, 17 members of the American Law Institute, 14 members of the Institute of Medicine, and 14 members of the National Academy of Engineering. Among other honors that university faculty, alumni, and researchers have won are two Nobel Prizes, one Fields Medal, a Presidential Medal of Freedom, three Pulitzer Prizes, three MacArthur Fellowships, and a National Medal of Scien ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Burrow
An Eastern chipmunk at the entrance of its burrow A burrow is a hole or tunnel excavated into the ground by an animal to construct a space suitable for habitation or temporary refuge, or as a byproduct of locomotion. Burrows provide a form of shelter against predation and exposure to the elements, and can be found in nearly every biome and among various biological interactions. Many animal species are known to form burrows. These species range from small invertebrates, such as the ''Corophium arenarium'', to very large vertebrate species such as the polar bear. Burrows can be constructed into a wide variety of substrates and can range in complexity from a simple tube a few centimeters long to a complex network of interconnecting tunnels and chambers hundreds or thousands of meters in total length; an example of the latter level of complexity, a well-developed burrow, would be a rabbit warren. Vertebrate burrows A large variety of vertebrates construct or use burrows in many t ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Desert
A desert is a barren area of landscape where little precipitation occurs and, consequently, living conditions are hostile for plant and animal life. The lack of vegetation exposes the unprotected surface of the ground to denudation. About one-third of the land surface of the Earth is arid or semi-arid. This includes much of the polar regions, where little precipitation occurs, and which are sometimes called polar deserts or "cold deserts". Deserts can be classified by the amount of precipitation that falls, by the temperature that prevails, by the causes of desertification or by their geographical location. Deserts are formed by weathering processes as large variations in temperature between day and night put strains on the rocks, which consequently break in pieces. Although rain seldom occurs in deserts, there are occasional downpours that can result in flash floods. Rain falling on hot rocks can cause them to shatter, and the resulting fragments and rubble strewn over the ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]  


picture info

Woodland
A woodland () is, in the broad sense, land covered with trees, or in a narrow sense, synonymous with wood (or in the U.S., the ''plurale tantum'' woods), a low-density forest forming open habitats with plenty of sunlight and limited shade (see differences between British, American, and Australian English explained below). Woodlands may support an understory of shrubs and herbaceous plants including grasses. Woodland may form a transition to shrubland under drier conditions or during early stages of primary or secondary succession. Higher-density areas of trees with a largely closed canopy that provides extensive and nearly continuous shade are often referred to as forests. Extensive efforts by conservationist groups have been made to preserve woodlands from urbanization and agriculture. For example, the woodlands of Northwest Indiana have been preserved as part of the Indiana Dunes. Definitions United Kingdom ''Woodland'' is used in British woodland management to mean tre ...
[...More Info...]      
[...Related Items...]     OR:     [Wikipedia]   [Google]   [Baidu]