|
Neuromedin (other)
Neuromedin may refer to: * Neuromedin B * Neuromedin N * Neuromedin S * Neuromedin U Neuromedin may refer to: * Neuromedin B * Neuromedin N * Neuromedin S Neuromedin S is a 36-amino acid neuropeptide found in the brain of humans and other mammals. It is produced in the suprachiasmatic nucleus of the hypothalamus and is related t ... {{disambig ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Neuromedin B
Neuromedin B (NMB) is a bombesin-related peptide in mammals. It was originally purified from pig spinal cord, and later shown to be present in human central nervous system and gastrointestinal tract. Sequence The sequence of the C-terminal decapeptide is highly conserved across mammalian species: GNLWATGHFM-(NH2); this decapeptide is sometimes noted as neuromedin B, but it is more accurately described as neuromedin B 23-32. The sequence of neuromedin B (in rat) is : TPFSWDLPEPRSRASKIRVHPRGNLWATGHFM-(NH2). Function Neuromedin regulates the following functions: * exocrine and endocrine secretions * cell growth * body temperature * blood pressure and glucose level * sneezing Neuromedin signaling pathway NMB acts by binding to its high affinity cell surface receptor, neuromedin B receptor (NMBR). This receptor is a G protein-coupled receptor with seven transmembrane spanning regions, hence the receptor is also denoted as a 7-transmembrane receptor (7-TMR). Upon binding ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Neuromedin N
Neuromedin N is a neuropeptide derived from the same precursor polypeptide as neurotensin, and with similar but subtly distinct expression and effects. References Neuropeptides {{biochem-stub ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Neuromedin S
Neuromedin S is a 36- amino acid neuropeptide found in the brain of humans and other mammals. It is produced in the suprachiasmatic nucleus of the hypothalamus and is related to neuromedin U. It is thought to be involved in regulation of circadian rhythm and also has appetite suppressant effects, as well as regulating the release of several other peptide hormones including vasopressin, luteinizing hormone, and oxytocin. See also * Neuromedin U receptor The neuromedin U receptors are two G-protein coupled receptor G protein-coupled receptors (GPCRs), also known as seven-(pass)-transmembrane domain receptors, 7TM receptors, heptahelical receptors, serpentine receptors, and G protein-linked ... References {{Neuropeptides Neuropeptides ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |