|
List Of Genetic Codes
While there is much commonality, different parts of the tree of life use slightly different genetic codes. When translating from genome to protein, the use of the correct genetic code is essential. The mitochondrial codes are the relatively well-known examples of variation. The list below follows the numbering and designation by NCBI. * Translation table 1: The standard code * Translation table 2: The vertebrate mitochondrial code * Translation table 3: The yeast mitochondrial code * Translation table 4: The mold, protozoan, and coelenterate mitochondrial code and the mycoplasma/spiroplasma code * Translation table 5: The invertebrate mitochondrial code * Translation table 6: The ciliate, dasycladacean and hexamita nuclear code * Translation table 7: The kinetoplast code; ''cf''. table 4. * Translation table 8: ''cf''. table 1. * Translation table 9: The echinoderm and flatworm mitochondrial code * Translation table 10: The euplotid nuclear code * Translation table 11: The ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Genetic Code
The genetic code is the set of rules used by living cells to translate information encoded within genetic material ( DNA or RNA sequences of nucleotide triplets, or codons) into proteins. Translation is accomplished by the ribosome, which links proteinogenic amino acids in an order specified by messenger RNA (mRNA), using transfer RNA (tRNA) molecules to carry amino acids and to read the mRNA three nucleotides at a time. The genetic code is highly similar among all organisms and can be expressed in a simple table with 64 entries. The codons specify which amino acid will be added next during protein biosynthesis. With some exceptions, a three-nucleotide codon in a nucleic acid sequence specifies a single amino acid. The vast majority of genes are encoded with a single scheme (see the RNA codon table). That scheme is often referred to as the canonical or standard genetic code, or simply ''the'' genetic code, though variant codes (such as in mitochondria) exist. History Effor ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Scenedesmus Obliquus Mitochondrial Code
The scenedesmus obliquus mitochondrial code (translation table 22) is a genetic code found in the mitochondria of ''Scenedesmus obliquus'', a species of green algae. Code Differences from the standard code Systematic range and comments * ''Scenedesmus obliquus'' See also * List of genetic codes While there is much commonality, different parts of the tree of life use slightly different genetic codes. When translating from genome to protein, the use of the correct genetic code is essential. The mitochondrial codes are the relatively well-k ... References Molecular genetics Gene expression Protein biosynthesis {{Genetics-stub ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
International Union Of Pure And Applied Chemistry
The International Union of Pure and Applied Chemistry (IUPAC ) is an international federation of National Adhering Organizations working for the advancement of the chemical sciences, especially by developing nomenclature and terminology. It is a member of the International Science Council (ISC). IUPAC is registered in Zürich, Switzerland, and the administrative office, known as the "IUPAC Secretariat", is in Research Triangle Park, North Carolina, United States. This administrative office is headed by IUPAC's executive director, currently Lynn Soby. IUPAC was established in 1919 as the successor of the International Congress of Applied Chemistry for the advancement of chemistry. Its members, the National Adhering Organizations, can be national chemistry societies, national academies of sciences, or other bodies representing chemists. There are fifty-four National Adhering Organizations and three Associate National Adhering Organizations. IUPAC's Inter-divisional Committee on ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Genetic Code
The genetic code is the set of rules used by living cells to translate information encoded within genetic material ( DNA or RNA sequences of nucleotide triplets, or codons) into proteins. Translation is accomplished by the ribosome, which links proteinogenic amino acids in an order specified by messenger RNA (mRNA), using transfer RNA (tRNA) molecules to carry amino acids and to read the mRNA three nucleotides at a time. The genetic code is highly similar among all organisms and can be expressed in a simple table with 64 entries. The codons specify which amino acid will be added next during protein biosynthesis. With some exceptions, a three-nucleotide codon in a nucleic acid sequence specifies a single amino acid. The vast majority of genes are encoded with a single scheme (see the RNA codon table). That scheme is often referred to as the canonical or standard genetic code, or simply ''the'' genetic code, though variant codes (such as in mitochondria) exist. History Effor ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Codon Reassignment
Codon reassignment is the biological process via which the genetic code of a cell is changed as a response to the environment. It may be caused by alternative tRNA aminoacylation, in which the cell modifies the target aminoacid of some particular type of transfer-RNA. This process has been identified in bacteria, yeast and human cancer cells. In human cancer cells, codon reassignment can be triggered by tryptophan depletion, resulting in proteins where the tryptophan aminoacid is substituted by phenylalanine. See also * Expanded genetic code An expanded genetic code is an artificially modified genetic code in which one or more specific codons have been re-allocated to encode an amino acid that is not among the 22 common naturally-encoded proteinogenic amino acids. The key prerequisit ... References {{Biology-stub Genetics Amino acids Biological processes Bacteria Yeasts Cancer ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Cephalodiscidae Mitochondrial Code
The Cephalodiscidae mitochondrial code (translation table 33) is a genetic code used by the mitochondrial genome of Cephalodiscidae ( Pterobranchia). The Pterobranchia are one of the two groups in the Hemichordata which together with the Echinodermata and Chordata form the major clades of deuterostomes. Code 33 is very similar to the mitochondrial code 24 for the Pterobranchia, which also belong to the Hemichordata, except that it uses UAA for tyrosine rather than as a stop codon. This code shares with many other mitochondrial codes the reassignment of the UGA STOP to tryptophan, and AGG and AGA to an amino acid other than arginine. However, the assignment of AGG to lysine in pterobranchian mitogenomes is not found elsewhere in deuterostome mitochondria but it occurs in some taxa of Arthropoda. The code : AAs = FFLLSSSSYYY*CCWWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSSKVVVVAAAADDEEGGGG : Starts = ---M-------*-------M---------------M---------------M------------ :&nb ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Blastocrithidia Nuclear Code
The ''Blastocrithidia'' nuclear code (translation table 31) is a genetic code used by the nuclear genome of the trypanosomatid genus ''Blastocrithidia''. The code (31) : AAs = FFLLSSSSYYEECCWWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG : Starts = ----------**-----------------------M---------------------------- : Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG : Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG : Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U). Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), T ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Peritrich Nuclear Code
The peritrich nuclear code (translation table 30) is a genetic code used by the nuclear genome of the peritrich ciliates ''Vorticella'' and ''Opisthonecta''. The code (30) : AAs = FFLLSSSSYYEECC*WLLLAPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG : Starts = --------------*--------------------M---------------------------- : Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG : Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG : Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U). Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Se ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Mesodinium Nuclear Code
The ''Mesodinium'' nuclear code (translation table 29) is a genetic code used by the nuclear genome of the ciliates ''Mesodinium'' and '' Myrionecta''. The code (29) : AAs = FFLLSSSSYYYYCC*WLLLAPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG : Starts = --------------*--------------------M---------------------------- : Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG : Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG : Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U). Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S) ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Condylostoma Nuclear Code
The ''Condylostoma'' nuclear code (translation table 28) is a genetic code used by the nuclear genome of the heterotrich ciliate ''Condylostoma magnum''. The code (28) : AAs = FFLLSSSSYYQQCCWWLLLAPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG : Starts = ----------**--*--------------------M---------------------------- : Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG : Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG : Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U). Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Th ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Karyorelict Nuclear Code
The karyorelictid nuclear code (translation table 27) is a genetic code used by the nuclear genome of the Karyorelictea ciliate ''Parduczia'' sp. The code (27) : AAs = FFLLSSSSYYQQCCWWLLLAPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG : Starts = --------------*--------------------M---------------------------- : Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG : Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG : Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U). Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine ( ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Pachysolen Tannophilus Nuclear Code
The pachysolen tannophilus nuclear code (translation table 26) is a genetic code found in the ascomycete fungus '' Pachysolen tannophilus''. Code Differences from the standard code Initiation codons This code uses the initiation codons AUG, GUG and UUG. Systematic range and comments * '' Pachysolen tannophilus'' See also * List of genetic codes While there is much commonality, different parts of the tree of life use slightly different genetic codes. When translating from genome to protein, the use of the correct genetic code is essential. The mitochondrial codes are the relatively well-k ... References {{Use dmy dates, date=August 2016 Molecular genetics Gene expression Protein biosynthesis ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
