|
IAPP (other)
IAPP may refer to: Science and technology * Islet amyloid polypeptide Amylin, or islet amyloid polypeptide (IAPP), is a 37-residue peptide hormone. It is co-secreted with insulin from the pancreatic β-cells in the ratio of approximately 100:1 (insulin:amylin). Amylin plays a role in glycemic regulation by slow ..., a protein produced by the pancreatic beta-cell that has been linked to type II diabetes * Inter-Access Point Protocol (IEEE 802.11F), an optional extension to IEEE 802.11 that provides wireless access-point communications among multivendor systems * iOS application or iApp Organisations * International Association of Panoramic Photographers * International Association of Privacy Professionals * International Association of Parliamentarians for Peace Education pathwayInternational Academic Preparation Program Focused on developing the academic foundation and English language proficiency for university studies, as well as potential credit exemptions, the I ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Islet Amyloid Polypeptide
Amylin, or islet amyloid polypeptide (IAPP), is a 37-residue peptide hormone. It is co-secreted with insulin from the pancreatic β-cells in the ratio of approximately 100:1 (insulin:amylin). Amylin plays a role in glycemic regulation by slowing gastric emptying and promoting satiety, thereby preventing post-prandial spikes in blood glucose levels. IAPP is processed from an 89-residue coding sequence. Proislet amyloid polypeptide (proIAPP, proamylin, proislet protein) is produced in the pancreatic beta cells (β-cells) as a 67 amino acid, 7404 Dalton pro-peptide and undergoes post-translational modifications including protease cleavage to produce amylin. Synthesis ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYL ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Inter-Access Point Protocol
Inter-Access Point Protocol or IEEE 802.11F is a recommendation that describes an optional extension to IEEE 802.11 that provides wireless access point communications among multivendor systems. 802.11 is a set of IEEE standards that govern wireless networking transmission methods. They are commonly used today in their 802.11a, 802.11b, 802.11g and 802.11n versions to provide wireless connectivity in the home, office and some commercial establishments. The IEEE 802.11 standard doesn't specify the communications between access points in order to support users roaming from one access point to another and load balancing. The 802.11 working group purposely did not define this element in order to provide flexibility in working with different wired and wireless distribution systems (i.e., wired backbones that interconnect access points). Protocol operation The protocol is designed for the enforcement of unique association throughout an Extended Service Set and for secure exchange of stat ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
IOS Application
The App Store is an app store platform, developed and maintained by Apple Inc., for mobile apps on its iOS and iPadOS operating systems. The store allows users to browse and download approved apps developed within Apple's iOS Software Development Kit. Apps can be downloaded on the iPhone, iPod Touch, or the iPad, and some can be transferred to the Apple Watch smartwatch or 4th-generation or newer Apple TVs as extensions of iPhone apps. The App Store was opened on July 10, 2008, with an initial 500 applications available. The number of apps peaked at around 2.2 million in 2017, but declined slightly over the next few years as Apple began a process to remove old or 32-bit apps that do not function as intended or that do not follow current app guidelines. , the store features more than 1.8 million apps. While Apple touts the role of the App Store in creating new jobs in the "app economy" and claims to have paid over $155 billion to developers, the App Store has also attracted ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
International Association Of Panoramic Photographers
The International Association of Panoramic Photographers (IAPP) is an international organization concerned with public awareness and appreciation for panoramic photography and immersive imaging. IAPP had its first meeting in April 1984. It is affiliated with the Professional Photographers of America and the headquarters are in Boca Raton, Florida, United States. Members are both amateur and professional photographers, including those from the arts, computer science fields, the film industry, journalism, NASA, etc. Members of the association provide technical assistance and share information about business options, color printing Color printing or colour printing is the reproduction of an image or text in color (as opposed to simpler black and white or monochrome printing). Any natural scene or color photograph can be optically and physiologically dissected into thre ... techniques, stock agency needs, etc. IAPP is "the leading professional organization for panoramic photog ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
International Association Of Privacy Professionals
The International Association of Privacy Professionals (IAPP) is a nonprofit, non-advocacy membership association founded in 2000. It provides a forum for privacy professionals to share best practices, track trends, advance privacy management issues, standardize the designations for privacy professionals, provide education and guidance on career opportunities in the field of information privacy. The IAPP offers a full suite of educational and professional development services, including privacy training, certification programs, publications and annual conferences. It is headquartered in Portsmouth, New Hampshire. History Founded in 2000, IAPP was originally constituted as the Privacy Officers Association (POA). In 2002, it became the International Association of Privacy Officers (IAPO) when the POA merged with a competing group, the Association of Corporate Privacy Officers (ACPO). The group was renamed to the International Association of Privacy Professionals in 2003 to reflect ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
