|
Brunner's Glands
Brunner's glands (or duodenal glands) are compound tubular submucosal glands found in that portion of the duodenum which is above the hepatopancreatic sphincter (i.e sphincter of Oddi). It also contains submucosa which creates special glands. The main function of these glands is to produce a mucus-rich alkaline secretion i.e. mucous (containing bicarbonate) in order to: * protect the duodenum from the acidic content of chyme (which is introduced into the duodenum from the stomach); * provide an alkaline condition for the intestinal enzymes to be active, thus enabling absorption to take place; * lubricate the intestinal walls. * They also secrete epidermal growth factor, which inhibits parietal and chief cells of the stomach from secreting acid and their digestive enzymes. This is another form of protection for the duodenum. They are the distinguishing feature of the duodenum, and are named for the Swiss physician who first described them, Johann Conrad Brunner. Structure Hi ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Duodenum
The duodenum is the first section of the small intestine in most higher vertebrates, including mammals, reptiles, and birds. In fish, the divisions of the small intestine are not as clear, and the terms anterior intestine or proximal intestine may be used instead of duodenum. In mammals the duodenum may be the principal site for iron absorption. The duodenum precedes the jejunum and ileum and is the shortest part of the small intestine. In humans, the duodenum is a hollow jointed tube about 25–38 cm (10–15 inches) long connecting the stomach to the middle part of the small intestine. It begins with the duodenal bulb and ends at the suspensory muscle of duodenum. Duodenum can be divided into four parts: the first (superior), the second (descending), the third (horizontal) and the fourth (ascending) parts. Structure The duodenum is a C-shaped structure lying adjacent to the stomach. It is divided anatomically into four sections. The first part of the duodenum lies ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Johann Conrad Brunner
Johann Conrad Brunner (16 January 1653 – 2 October 1727) was a Swiss anatomist, especially cited for his work on the pancreas and duodenum. Life Brunner was born in Diessenhofen, and studied medicine in Schaffhausen, Strasbourg, Amsterdam, London and Paris. At Schaffhausen he studied under Johann Jakob Wepfer (1620–1695), who was also his father-in-law. He received his doctorate in 1672 from the University of Strasbourg. Beginning in 1686 he was a professor of anatomy and physiology at the University of Heidelberg. In 1716, Brunner was appointed personal physician to Charles III Philip the new Elector of the Palatinate. He received many accolades during his life including a knighthood with the title "Brunn von Hammerstein". He died in 1727 in Mannheim, Germany. Work Brunner is remembered for his experiments and studies of the pancreas and the internal secretions associated with that organ. In 1683 he removed the pancreas from a dog and noticed that the animal experien ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Pedunculated
A peduncle is an elongated stalk of tissue. Sessility is the state of not having a peduncle; a sessile mass or structure lacks a stalk. In medicine, a mass such as a cyst or polyp is said to be ''pedunculated'' if it is supported by a peduncle. There are in total three types of peduncles in the cerebellum of the human brain, known as superior cerebellar peduncle, middle cerebellar peduncle, and inferior cerebellar peduncle. Pedunculated eyes are also the defining attribute of the Stylophthalmine trait found in certain fish larvae. The caudal peduncle is a slightly narrowed part of a fish where the caudal fin meets the spine. See also *Peduncle (botany) In botany, a peduncle is a stalk supporting an inflorescence or a solitary flower, or, after fecundation, an infructescence or a solitary fruit. The peduncle sometimes has bracts (a type of cataphylls) at nodes. The main axis of an infloresce ... References Gross pathology {{anatomy-stub ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Hamartoma
A hamartoma is a mostly benign, local malformation of cells that resembles a neoplasm of local tissue but is usually due to an overgrowth of multiple aberrant cells, with a basis in a systemic genetic condition, rather than a growth descended from a single mutated cell ( monoclonality), as would typically define a benign neoplasm/tumor. Despite this, many hamartomas are found to have clonal chromosomal aberrations that are acquired through somatic mutations, and on this basis the term ''hamartoma'' is sometimes considered synonymous with neoplasm. Hamartomas are by definition benign, slow-growing or self-limiting, though the underlying condition may still predispose the individual towards malignancies. Hamartomas are usually caused by a genetic syndrome that affects the development cycle of all or at least multiple cells. Many of these conditions are classified as overgrowth syndromes or cancer syndromes. Hamartomas occur in many different parts of the body and are most often asy ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Urogastrone
Epidermal growth factor (EGF) is a protein that stimulates cell growth and differentiation by binding to its receptor, EGFR. Human EGF is 6-k Da and has 53 amino acid residues and three intramolecular disulfide bonds. EGF was originally described as a secreted peptide found in the submaxillary glands of mice and in human urine. EGF has since been found in many human tissues, including platelets, submandibular gland (submaxillary gland), and parotid gland. Initially, human EGF was known as urogastrone. Structure In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42). Function EGF, via binding to its cognate receptor, results in cellular proliferation, differentiation, and survival. Salivary EGF, which seems to be regulated by dietary inorganic iodine, also plays an important physiological role in the maintenance of ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Pepsinogen
Pepsin is an endopeptidase that breaks down proteins into smaller peptides. It is produced in the gastric chief cells of the stomach lining and is one of the main digestive enzymes in the digestive systems of humans and many other animals, where it helps digest the proteins in food. Pepsin is an aspartic protease, using a catalytic aspartate in its active site. It is one of three principal endopeptidases (enzymes cutting proteins in the middle) in the human digestive system, the other two being chymotrypsin and trypsin. There are also exopeptidases which remove individual amino acids at both ends of proteins (carboxypeptidases produced by the pancreas and aminopeptidases secreted by the small intestine). During the process of digestion, these enzymes, each of which is specialized in severing links between particular types of amino acids, collaborate to break down dietary proteins into their components, i.e., peptides and amino acids, which can be readily absorbed by the small ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Mucin
Mucins () are a family of high molecular weight, heavily glycosylated proteins (glycoconjugates) produced by epithelial tissues in most animals. Mucins' key characteristic is their ability to form gels; therefore they are a key component in most gel-like secretions, serving functions from lubrication to cell signalling to forming chemical barriers. They often take an inhibitory role. Some mucins are associated with controlling mineralization, including nacre formation in mollusks, calcification in echinoderms and bone formation in vertebrates. They bind to pathogens as part of the immune system. Overexpression of the mucin proteins, especially MUC1, is associated with many types of cancer. Although some mucins are membrane-bound due to the presence of a hydrophobic membrane-spanning domain that favors retention in the plasma membrane, most mucins are secreted as principal components of mucus by mucous membranes or are secreted to become a component of saliva. Genes Human muci ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Intestinal Glands
In histology, an intestinal gland (also crypt of Lieberkühn and intestinal crypt) is a gland found in between villi in the intestinal epithelium lining of the small intestine and large intestine (or colon). The glands and intestinal villi are covered by epithelium, which contains multiple types of cells: enterocytes (absorbing water and electrolytes), goblet cells (secreting mucus), enteroendocrine cells (secreting hormones), cup cells, tuft cells, and at the base of the gland, Paneth cells (secreting anti-microbial peptides) and stem cells. Structure Intestinal glands are found in the epithelia of the small intestine, namely the duodenum, jejunum, and ileum, and in the large intestine (colon), where they are sometimes called ''colonic crypts''. Intestinal glands of the small intestine contain a base of replicating stem cells, Paneth cells of the innate immune system, and goblet cells, which produce mucus. In the colon, crypts do not have Paneth cells. Function The ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Ileum
The ileum () is the final section of the small intestine in most higher vertebrates, including mammals, reptiles, and birds. In fish, the divisions of the small intestine are not as clear and the terms posterior intestine or distal intestine may be used instead of ileum. Its main function is to absorb vitamin B12, bile salts, and whatever products of digestion that were not absorbed by the jejunum. The ileum follows the duodenum and jejunum and is separated from the cecum by the ileocecal valve (ICV). In humans, the ileum is about 2–4 m long, and the pH is usually between 7 and 8 (neutral or slightly basic). ''Ileum ''is derived from the Greek word ''eilein'', meaning "to twist up tightly". Structure The ileum is the third and final part of the small intestine. It follows the jejunum and ends at the ileocecal junction, where the terminal ileum communicates with the cecum of the large intestine through the ileocecal valve. The ileum, along with the jejunum, is suspended ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Jejunum
The jejunum is the second part of the small intestine in humans and most higher vertebrates, including mammals, reptiles, and birds. Its lining is specialised for the absorption by enterocytes of small nutrient molecules which have been previously digested by enzymes in the duodenum. The jejunum lies between the duodenum and the ileum and is considered to start at the suspensory muscle of the duodenum, a location called the duodenojejunal flexure. The division between the jejunum and ileum is not anatomically distinct. In adult humans, the small intestine is usually long (post mortem), about two-fifths of which (about ) is the jejunum. Structure The interior surface of the jejunum—which is exposed to ingested food—is covered in finger–like projections of mucosa, called villi, which increase the surface area of tissue available to absorb nutrients from ingested foodstuffs. The epithelial cells which line these villi have microvilli. The transport of nutrients across epi ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Switzerland
). Swiss law does not designate a ''capital'' as such, but the federal parliament and government are installed in Bern, while other federal institutions, such as the federal courts, are in other cities (Bellinzona, Lausanne, Luzern, Neuchâtel, St. Gallen a.o.). , coordinates = , largest_city = Zürich , official_languages = , englishmotto = "One for all, all for one" , religion_year = 2020 , religion_ref = , religion = , demonym = , german: Schweizer/Schweizerin, french: Suisse/Suissesse, it, svizzero/svizzera or , rm, Svizzer/Svizra , government_type = Federalism, Federal assembly-independent Directorial system, directorial republic with elements of a direct democracy , leader_title1 = Federal Council (Switzerland), Federal Council , leader_name1 = , leader_title2 = , leader_name2 = Walter Thurnherr , legislature = Fe ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
