|
Antheraea Pernyi
''Antheraea pernyi'', the Chinese (oak) tussar moth, Chinese tasar moth or temperate tussar moth, is a large moth in the family Saturniidae. The species was first described by Félix Édouard Guérin-Méneville in 1855. '' Antheraea roylei'' is an extremely close relative, and the present species might actually have evolved from ancestral ''A. roylei'' by chromosome rearrangement. They are originally from southern China. Used for tussar silk production, they have been distributed more widely across subtropical and tropical Asia. Unlike the domestic silk moth which is entirely dependent on human care, tussah silk moths can survive in the wild if they escape from captivity; small local populations of such feral stock may thus occasionally occur. The colour and quality of the silk depends on the climate and soil. This is one of the major producers of tussar silk. It was of commercial importance during the Han Dynasty and early Three Kingdoms era, about 200 BC to 250 AD. More rece ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Félix Édouard Guérin-Méneville
Félix Édouard Guérin-Méneville, also known as F. E. Guerin, (12 October 1799, in Toulon – 26 January 1874, in Paris) was a French entomologist. Life and work Guérin-Méneville changed his surname from Guérin in 1836. He was the author of the illustrated work ''Iconographie du Règne Animal de G. Cuvier 1829–1844'', a complement to the work of the zoologists Georges Cuvier and Pierre André Latreille, ''Le Règne Animal'', which illustrated only a selection of the animals covered. Cuvier was delighted with the work, saying that it would be very useful to readers, and that the illustrations were "as accurate as they were elegant". He also introduced silkworms to France, so they could be bred for the production of silk. Guérin-Méneville founded several journals: ''Magasin de zoologie, d’anatomie comparée et de paléontologie'' (1830), ''Revue zoologique par la Société cuviérienne'' (1838), ''Revue et Magasin de zoologie pure et appliquée'' (1849), and ''Revue de ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Paternal MtDNA Transmission
In genetics, paternal mtDNA transmission and paternal mtDNA inheritance refer to the incidence of mitochondrial DNA (mtDNA) being passed from a father to his offspring. Paternal mtDNA inheritance is observed in a small proportion of species; in general, mtDNA is passed unchanged from a mother to her offspring, making it an example of non-Mendelian inheritance. In contrast, mtDNA transmission from both parents occurs regularly in certain bivalves. In animals Paternal mtDNA inheritance in animals varies. For example, in Mytilidae mussels, paternal mtDNA "is transmitted through the sperm and establishes itself only in the male gonad." In testing 172 sheep, "The Mitochondrial DNA from three lambs in two half-sib families were found to show paternal inheritance." An instance of paternal leakage resulted in a study on chickens. There has been evidences that paternal leakage is an integral part of mitochondrial inheritance of '' Drosophila simulans''. In humans In human mitochondr ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Baculoviridae
''Baculoviridae'' is a family of viruses. Arthropods, among the most studied being Lepidoptera, Hymenoptera and Diptera, serve as natural hosts. Currently, 85 species are placed in this family, assigned to four genera. Baculoviruses are known to infect insects, with over 600 host species having been described. Immature (larval) forms of lepidopteran species (moths and butterflies) are the most common hosts, but these viruses have also been found infecting sawflies, and mosquitoes. Although baculoviruses are capable of entering mammalian cells in culture, they are not known to be capable of replication in mammalian or other vertebrate animal cells. Starting in the 1940s, they were used and studied widely as biopesticides in crop fields. Baculoviruses contain a circular, double-stranded DNA (dsDNA) genome ranging from 80 to 180 kbp. Historical influence The earliest records of baculoviruses can be found in the literature from as early as the 16th century in reports of "wilt ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Galactose
Galactose (, '' galacto-'' + ''-ose'', "milk sugar"), sometimes abbreviated Gal, is a monosaccharide sugar that is about as sweet as glucose, and about 65% as sweet as sucrose. It is an aldohexose and a C-4 epimer of glucose. A galactose molecule linked with a glucose molecule forms a lactose molecule. Galactan is a polymeric form of galactose found in hemicellulose, and forming the core of the galactans, a class of natural polymeric carbohydrates. D-Galactose is also known as brain sugar since it is a component of glycoproteins (oligosaccharide-protein compounds) found in nerve tissue. Etymology The word ''galactose'' was coined by Charles Weissman in the mid-19th century and is derived from Greek ''galaktos'' (of milk) and the generic chemical suffix for sugars ''-ose''. The etymology is comparable to that of the word ''lactose'' in that both contain roots meaning "milk sugar". Lactose is a disaccharide of galactose plus glucose. Structure and isomerism Galactose exists in ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Lectin
Lectins are carbohydrate-binding proteins that are highly specific for sugar groups that are part of other molecules, so cause agglutination of particular cells or precipitation of glycoconjugates and polysaccharides. Lectins have a role in recognition at the cellular and molecular level and play numerous roles in biological recognition phenomena involving cells, carbohydrates, and proteins. Lectins also mediate attachment and binding of bacteria, viruses, and fungi to their intended targets. Lectins are ubiquitous in nature and are found in many foods. Some foods, such as beans and grains, need to be cooked, fermented or sprouted to reduce lectin content. Some lectins are beneficial, such as CLEC11A, which promotes bone growth, while others may be powerful toxins such as ricin. Lectins may be disabled by specific mono- and oligosaccharides, which bind to ingested lectins from grains, legumes, nightshade plants, and dairy; binding can prevent their attachment to the carbohyd ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Hemolymph
Hemolymph, or haemolymph, is a fluid, analogous to the blood in vertebrates, that circulates in the interior of the arthropod (invertebrate) body, remaining in direct contact with the animal's tissues. It is composed of a fluid plasma in which hemolymph cells called hemocytes are suspended. In addition to hemocytes, the plasma also contains many chemicals. It is the major tissue type of the open circulatory system characteristic of arthropods (e.g. arachnids, crustaceans and insects). In addition, some non-arthropods such as molluscs possess a hemolymphatic circulatory system. Oxygen-transport systems were long thought unnecessary in insects, but ancestral and functional hemocyanin has been found in the hemolymph. Insect "blood" generally does not carry hemoglobin, although hemoglobin may be present in the tracheal system instead and play some role in respiration. Method of transport In the grasshopper, the closed portion of the system consists of tubular hearts and an ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Lysozyme
Lysozyme (EC 3.2.1.17, muramidase, ''N''-acetylmuramide glycanhydrolase; systematic name peptidoglycan ''N''-acetylmuramoylhydrolase) is an antimicrobial enzyme produced by animals that forms part of the innate immune system. It is a glycoside hydrolase that catalyzes the following process: : Hydrolysis of (1→4)-β-linkages between ''N''-acetylmuramic acid and ''N''-acetyl-D-glucosamine residues in a peptidoglycan and between ''N''-acetyl-D-glucosamine residues in chitodextrins Peptidoglycan is the major component of gram-positive bacterial cell wall. This hydrolysis in turn compromises the integrity of bacterial cell walls causing lysis of the bacteria. Lysozyme is abundant in secretions including tears, saliva, human milk, and mucus. It is also present in cytoplasmic granules of the macrophages and the polymorphonuclear neutrophils (PMNs). Large amounts of lysozyme can be found in egg white. C-type lysozymes are closely related to α-lactalbumin in sequence and struc ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Attacin
Attacin is a glycine-rich protein of about 20 kDa belonging to the group of antimicrobial peptides (AMP). It is active against Gram-negative bacteria Gram-negative bacteria are bacteria that do not retain the crystal violet stain used in the Gram staining method of bacterial differentiation. They are characterized by their cell envelopes, which are composed of a thin peptidoglycan cell wall .... Attacin was first discovered in '' Hyalophora cecropia'', but is widely conserved in different insects from butterflies to fruit flies. See also * Diptericin, a structurally related antimicrobial peptide References {{Reflist Insect immunity Antimicrobial peptides ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Hemolin
Hemolin is an immunoglobulin-like protein exclusively found in Lepidoptera (moths and butterflies). It was first discovered in immune-challenged pupae of '' Hyalophora cecropia'' and '' Manduca sexta''. Hemolin has a horseshoe crystal structure with four domains and resembles the developmental protein neuroglian. Hemolin increases 18-fold up to 7 mg/ml following injection of bacteria in ''H. cecropia''. Induction of Hemolin in moths after bacterial injection have been shown in several species including '' Antheraea pernyi'', ''Bombyx mori'', '' Helicoverpa zea'', ''Heliothis virescens'', '' Hyphantria cunea'', and '' Samia cynthia''. Hemolin has also been suggested to participate in the immune response to virus infection and shown to bind to virus particles. It is expressed in response to dsRNA in a dose-dependent manner. '' Galleria melonella'' responds to caffeine intake by increased Hemolin protein expression. Hemolin is thought to be a gene duplication of the deve ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Cecropin
Cecropins are antimicrobial peptides. They were first isolated from the hemolymph of ''Hyalophora cecropia'', whence the term cecropin was derived. Cecropins lyse bacterial cell membranes; they also inhibit proline uptake and cause leaky membranes. Cecropins constitute a main part of the innate immune system of insects. Cecropins are small proteins anywhere from 31 - 37 amino acids long and are active against both gram-positive and gram-negative bacteria. Cecropins isolated from insects other than ''Hyalophora cecropia'' (Cecropia moth) have been given various names, such as bactericidin, lepidopterin, and sarcotoxin. All of these peptides are structurally related. Members Members include: ;Cecropin A: Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. ;Cecropin B: Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Escherichia Coli
''Escherichia coli'' (),Wells, J. C. (2000) Longman Pronunciation Dictionary. Harlow ngland Pearson Education Ltd. also known as ''E. coli'' (), is a Gram-negative, facultative anaerobic, rod-shaped, coliform bacterium of the genus '' Escherichia'' that is commonly found in the lower intestine of warm-blooded organisms. Most ''E. coli'' strains are harmless, but some serotypes ( EPEC, ETEC etc.) can cause serious food poisoning in their hosts, and are occasionally responsible for food contamination incidents that prompt product recalls. Most strains do not cause disease in humans and are part of the normal microbiota of the gut; such strains are harmless or even beneficial to humans (although these strains tend to be less studied than the pathogenic ones). For example, some strains of ''E. coli'' benefit their hosts by producing vitamin K2 or by preventing the colonization of the intestine by pathogenic bacteria. These mutually beneficial relationships between ''E ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
Antheraea Polyphemus
''Antheraea polyphemus'', the Polyphemus moth, is a North American member of the family Saturniidae, the giant silk moths. It is a tan-colored moth, with an average wingspan of 15 cm (6 in). The most notable feature of the moth is its large, purplish eyespots on its two hindwings. The eyespots give it its name – from the Greek myth of the cyclops Polyphemus. The species was first described by Pieter Cramer in 1776. The species is widespread in continental North America, with local populations found throughout subarctic Canada and the United States. The caterpillar can eat 86,000 times its weight at emergence in a little less than two months. Life cycle The life cycle of the moth is much like that of any other Saturniidae species. It lays flat, light-brown eggs on the leaves of a number of host trees, preferring ''Ulmus americana'' (American elm), ''Betula'' (birch), ''Salix'' (willow), but also, more rarely, can survive on other trees, including: ''Quercus'' (oak), ... [...More Info...] [...Related Items...] OR: [Wikipedia] [Google] [Baidu] |
